KEGG   Salmonella enterica subsp. enterica serovar Typhimurium T000240: STMDT12_L00660Help
Entry
STMDT12_L00660    CDS       T01742                                 

Definition
dihydrofolate reductase
Orthology
K18590  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
sem  Salmonella enterica subsp. enterica serovar Typhimurium T000240
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:sem00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STMDT12_L00660
   00670 One carbon pool by folate
    STMDT12_L00660
Enzymes [BR:sem01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     STMDT12_L00660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
Position
pSTMDT12_L:complement(46971..47468)
Genome map
AA seq 165 aa AA seqDB search
MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGKVVVMGRKTFESIGKPL
PNRHTLVISRQANYRATGCVVVSTLSHAIALASELGNELYVAGGAEIYTLALPHAHGVFL
SEVHQTFEGDAFFPMLNETEFELVSTETIQAVIPYTHSVYARRNG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaactcggaatcagtacgcatttatctcgttgctgcgatgggagccaatcgggttatt
ggcaatggtcctaatatcccctggaaaattccgggtgagcagaagatttttcgcagactc
actgagggaaaagtcgttgtcatggggcgaaagacctttgagtctatcggcaagcctcta
ccgaaccgtcacacattggtaatctcacgccaagctaactaccgcgccactggctgcgta
gttgtttcaacgctgtcgcacgctatcgctttggcatccgaactcggcaatgaactctac
gtcgcgggcggagctgagatatacactctggcactacctcacgcccacggcgtgtttcta
tctgaggtacatcaaaccttcgagggtgacgccttcttcccaatgctcaacgaaacagaa
ttcgagcttgtctcaaccgaaaccattcaagctgtaattccgtacacccactccgtttat
gcgcgtcgaaacggctaa

DBGET integrated database retrieval system