KEGG   Saccharopolyspora erythraea: SACE_0125Help
Entry
SACE_0125         CDS       T00492                                 

Gene name
cyp20
Definition
cytochrome P450 (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sen00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sen00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sen00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(152305..153462)
Genome map
AA seq 385 aa AA seqDB search
MFDTADPAFVADPYPCFAELRRRGEVHRHPGLGMAVAVSHAAASEVLRHRGLGRIWVDAQ
PAADFPAFNLLHRTSLLETEGAEHTRLRRSISAAFARGHVERVRPWVAGLADALVGGLVE
RGGGDVVEEVAAPLPVQVIAELLGVPESDRNLLRPWSNAIVKMYEPGLPERRRAAAESAA
AEFAEYMRALADRRRSAPADDMVSDLVAAEELSADEVVGTAVLLLMAGHEASVNLVANGV
LALLRHPGQWRRLVDDPGLVPTAVEELIRYDSPLQLFERTAVEDVVVAGHRVAAGSKIAA
LLGAAARDPEVFESPDVLDVGRQPNPHLGFGAGIHYCLGAPLARVEAAAALSALVRLAPR
LEQAGEPVRRPEFVIRGLRELPVSV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacaccgccgatccggccttcgtcgccgacccctacccgtgcttcgccgagctg
cgccgacggggcgaggtgcaccggcacccggggctcgggatggcggtcgccgtttcccac
gccgccgcctccgaggtgctgcggcaccgcgggctcggccggatctgggtggacgcgcag
cccgccgcggacttccccgccttcaacctgctgcaccgcacctcgctgctggagaccgag
ggggctgagcacacccggctgcgccgcagcatcagcgcggccttcgcgcgcggccacgtc
gagcgggtgcggccgtgggtcgccggactggccgacgcgctggtcggcggcctcgtcgag
cgcggcggcggagacgtcgtcgaggaggtcgccgcgccgctgccggtgcaggtgatcgcg
gagctgctgggggtgcccgagtccgaccggaacctgttgcggccgtggtcgaacgcgatc
gtgaagatgtacgagccgggcctgcccgaacgcaggcgcgcggcggcggagtcggccgcg
gcggagttcgccgagtacatgcgcgcgctggccgaccggcggcgctcggccccggccgac
gacatggtcagcgacctggtggccgccgaggagctaagcgcggacgaggtcgtcggcacc
gcggtgctgctgctcatggccggccacgaggccagcgtcaacctggtggccaacggggtg
ctcgcgctgctgcgccaccccggccagtggcggcggctcgtcgacgaccccggcctggtt
ccgaccgccgtcgaggagctgatccgctacgactcgccgctgcagctcttcgagcgcacc
gcggtcgaggacgtcgtggtcgccgggcaccgcgtggcggcggggtcgaagatcgccgcg
ctgctcggcgcggcggcgcgcgacccggaggtgttcgagtcgccggacgtgctcgacgtc
gggcggcagccgaacccgcacctcggtttcggcgccggcatccattactgcctcggcgcg
ccgctcgcgcgggtggaggccgccgccgcgctgtcggcactggtgcggctggcgccgcga
ctggagcaggcgggcgaaccggtgcggcgcccggagttcgtcatccgcggtctgcgggaa
ctgcccgtctcggtttga

DBGET integrated database retrieval system