KEGG   Saccharopolyspora erythraea: SACE_0175Help
Entry
SACE_0175         CDS       T00492                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sen00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sen00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sen02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
201855..203429
Genome map
AA seq 524 aa AA seqDB search
MSDPTTVSRRSVLLGGTAAGAVALSTGAALPAAAQQGAGFARRGEVFTLGVASGDPAPDG
VVLWTRLAADPIAEDGMGGMPDKTFPVQWEVAEDERFHRVVQRGEAQAAPSLGHSVHVEL
TGLRPDREYFYRFRAEGAVSPVGRTRTAPLPGAMTELTMAFASCAQFEHGFFTAYRHLAE
EHPDLVLHLGDYQYEYKAGDYVIPGGNIRDHAGPETTTLANYRQRHAQYKSDPDLQFAHA
AAPWVVVWDDHELDNNWADEIHEKPEKPQPDFLERRKAAFQAYYENMPLRRAQIPKGIDL
RLHRRIEWGRLATFHMLDTRQYRDDQVGGDKVPTTDPARLDPARSLTGAEQERWLLTNLR
SSQARWDVLGQQVMFAEIDLAEGDAEGYNPDAWDGYVGSRQRVIQGFQQGKVRNPVVLTG
DVHKNWANDVQSDGRTVATELTTTSITSGGDGSESLTEKEKGYLRDNPHVRFYSNQRGYI
RTRFTEGELRADYRVVPYVSKPGAPVRTAASFVVEDGRPGLNPA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgatcccaccaccgtttcgcgccggagcgtgctgctcggcggcacggccgccggc
gccgtcgcgctctccacgggcgccgcgctgcccgctgccgcgcagcagggtgccggcttc
gcccgccgcggcgaggtgttcaccctcggcgtcgcctccggcgacccggcccccgacggc
gtggtgctgtggacccggctcgccgccgacccgatcgccgaggacggcatgggcggcatg
ccggacaagaccttccccgtgcagtgggaggtcgccgaggacgagcggttccaccgcgtc
gtccagcgcggtgaggcgcaggccgccccgagcctcggccacagcgtgcacgtcgagctg
accgggctgcgcccggaccgcgagtacttctaccgcttccgcgccgagggcgccgtctcg
ccggtcggccgcacccggacggcgccgctgccgggcgcgatgaccgagctgaccatggcc
ttcgcctcgtgcgcgcagttcgagcacggcttcttcaccgcctaccgccacctcgccgag
gagcacccggacctggtgctgcacctgggcgactaccagtacgagtacaaggccggcgac
tacgtgatccccggcggcaacatccgagaccacgccggccccgagaccacgacgctggcc
aactaccgacagcggcacgcgcagtacaagtcggacccggacctgcagttcgcgcacgcg
gccgcgccgtgggtcgtggtgtgggacgaccacgagctcgacaacaactgggccgacgag
atccacgagaagccggagaagccgcagccggacttcctggagcgccgcaaggccgccttc
caggcgtactacgagaacatgccgctgcgccgggcccagatccccaaggggatcgacctg
cggctgcaccgccgcatcgagtggggccggctggcgacgttccacatgctcgacacccgc
cagtaccgcgacgaccaggtcggcggtgacaaggtgccgaccacggacccggcccggctg
gaccccgcgcgcagcctgaccggcgcggagcaggagcgctggctgctcacgaacctgcgg
tcgtcgcaggcgcgctgggacgtgctcggccagcaggtcatgttcgccgagatcgacctg
gccgagggtgacgccgagggctacaaccccgacgcctgggacggctacgtcggatcgcgg
cagcgcgtcatccagggcttccagcagggcaaggtgcgcaacccggtcgtgctgaccggt
gacgtgcacaagaactgggccaacgacgtgcagagcgacggccgcacggtggccaccgag
ctgaccaccacgtcgatcaccagcggtggcgacggctcggagtcgttgaccgagaaggag
aagggctacctgcgggacaacccgcacgtgcgcttctacagcaaccagcgcggctacatc
cgcaccaggttcaccgagggcgagctgcgcgcggactaccgcgtggtgccgtacgtgtcg
aagccgggcgctccggtgcgcaccgccgccagcttcgtggtcgaggacggcaggcccggc
ctcaacccggcgtga

DBGET integrated database retrieval system