KEGG   Saccharopolyspora erythraea: SACE_0306Help
Entry
SACE_0306         CDS       T00492                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACE_0306 (bga)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SACE_0306 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(341064..342848)
Genome map
AA seq 594 aa AA seqDB search
MGGTNRVLAQAGKPAGLTVRGNEFLLDGEPFRIIAGEMHYFRTHPDQWRNRLDRMRALGL
NSVDTYVAWNFHEPRRGEVDFTGWRDVVRFVETAAEAGLKVIIRPGPYICAEWDFGGLPA
WLLESGNPPLRCSDPAYTELTLRWFDELLPRLAPLQATRGGPVLAFQVENEYGSYGNDQT
HLEQLRAGMLERGIDSLLFCSNGPSDYMLRGGNLPDTLATVNFAGDPTAPFEALREYQPE
GPLWCTEFWDGWFDHWGEEHHTTDPVETAGHVDRMLAAGASVSLYMAVGGTNFGWWAGAN
YDTSKDQYQPTITSYDYDSPIGEAGELTEKFQRIREAIARHAPVPEPPLPAPPPRLRPQT
ARPEATTGLLESLDVLSSPVRSATPAHMEKFGQPYGLIHYRTTVQGPRQTAGLRVSGLAD
RALVFSDGKYLGALDRNTPDLTIDVAVPGRTGRLDLLVDTGGRVNFGHQLSDPKGITDRV
LLGMQALHGWEIRPLPLEDLSGLRFGGGTSAGPVFHRARMSIAEPADGFLALPGWEKGMV
WLNGFLLGRYWSVGPQVTLYAPSPLWKQGENEIVVLEMHEAGQDIELRSEPDLG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaccaaccgggtgctcgcccaggccggcaagcccgccgggttgaccgtgcgc
ggcaacgagttcctgctcgacggcgagccgttccgcatcatcgccggcgagatgcactac
ttccgcacccatcccgaccagtggcgcaaccggctggaccggatgcgggcgctggggctg
aactccgtcgacacctacgtcgcgtggaacttccacgagccgcggcgcggggaggtcgac
ttcaccggctggcgggacgtcgtccggttcgtcgagacggcggcggaggccgggctcaag
gtgatcatccgccccggcccgtacatctgcgcggagtgggacttcggcgggcttcccgcg
tggctgctggagtccgggaacccgccgctgcggtgcagcgaccccgcctacaccgagctg
acgctgcggtggttcgacgagctgctgccgcgcctcgcaccgttgcaggcgacccggggc
ggcccggtgctggcgttccaggtggagaacgagtacggcagctacggcaacgaccagacg
cacctggagcagctcagggcgggcatgctggagcgcggcatcgacagcctgctgttctgc
tccaacggcccttcggactacatgctgcgcggcgggaacctgccggacacgctcgcgacg
gtcaacttcgccggtgatccgacggccccgttcgaggcgctgcgcgagtaccagccggag
ggaccgctgtggtgcaccgagttctgggacggctggttcgaccactggggcgaggagcac
cacacgaccgatccggtcgagaccgcgggccacgtcgaccggatgctggcggccggcgcg
tcggtgtcgctctacatggcggtcggcggcacgaacttcggctggtgggccggtgccaac
tacgacacctccaaggaccagtaccagccgacgatcaccagctacgactacgactccccg
atcggcgaggcaggcgagctgaccgagaagttccagcggatccgcgaggccatcgccagg
cacgcgccggttcccgagccgccgctgcccgcgccgccgcctcggctgcggccgcagacc
gcgcggccggaggcgactaccggactgctggagtcgctcgacgtcctcagctcgccggtg
cgcagcgcgactccggcgcacatggagaagttcggccagccctacggcctgatccactac
cgcaccacggtccaggggccgcgccagacggccggactgcgggtgtccggcctcgccgac
cgcgcgctcgtattcagtgacggcaagtacctcggcgcgctggaccgcaacaccccggac
ctgacgatcgacgtcgccgtgcccggccggaccgggcggctggacctgctcgtagacacc
ggcgggcgggtcaacttcgggcaccagctcagcgacccgaagggcatcaccgaccgggtg
ctgctcggcatgcaggccctgcacggctgggagatccggccgctgccgctggaggacctg
tccgggctgcggttcggcggtgggacgtcggccgggccggtgttccaccgcgcgcggatg
tcgatcgccgaacctgcggacgggttcctggcgcttcccggctgggagaaggggatggtc
tggctcaacggcttcctgctcggccggtactggtcggtcggaccgcaggtcaccctctac
gcgccgagtccgctgtggaagcagggcgagaacgagatcgtggtgctggagatgcacgag
gccgggcaggacatcgaactgcgctccgagcccgacctcggctag

DBGET integrated database retrieval system