KEGG   Saccharopolyspora erythraea: SACE_0306Help
Entry
SACE_0306         CDS       T00492                                 

Gene name
bga
Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACE_0306 (bga)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SACE_0306 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5 Cellulase PRIMA1
Motif
Other DBs
NCBI-ProteinID: CAL99655
Cambridge: SACE_0306
Kitasato: SACE_0306
UniProt: A4F6I1
Position
complement(341064..342848)
Genome map
AA seq 594 aa AA seqDB search
MGGTNRVLAQAGKPAGLTVRGNEFLLDGEPFRIIAGEMHYFRTHPDQWRNRLDRMRALGL
NSVDTYVAWNFHEPRRGEVDFTGWRDVVRFVETAAEAGLKVIIRPGPYICAEWDFGGLPA
WLLESGNPPLRCSDPAYTELTLRWFDELLPRLAPLQATRGGPVLAFQVENEYGSYGNDQT
HLEQLRAGMLERGIDSLLFCSNGPSDYMLRGGNLPDTLATVNFAGDPTAPFEALREYQPE
GPLWCTEFWDGWFDHWGEEHHTTDPVETAGHVDRMLAAGASVSLYMAVGGTNFGWWAGAN
YDTSKDQYQPTITSYDYDSPIGEAGELTEKFQRIREAIARHAPVPEPPLPAPPPRLRPQT
ARPEATTGLLESLDVLSSPVRSATPAHMEKFGQPYGLIHYRTTVQGPRQTAGLRVSGLAD
RALVFSDGKYLGALDRNTPDLTIDVAVPGRTGRLDLLVDTGGRVNFGHQLSDPKGITDRV
LLGMQALHGWEIRPLPLEDLSGLRFGGGTSAGPVFHRARMSIAEPADGFLALPGWEKGMV
WLNGFLLGRYWSVGPQVTLYAPSPLWKQGENEIVVLEMHEAGQDIELRSEPDLG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaccaaccgggtgctcgcccaggccggcaagcccgccgggttgaccgtgcgc
ggcaacgagttcctgctcgacggcgagccgttccgcatcatcgccggcgagatgcactac
ttccgcacccatcccgaccagtggcgcaaccggctggaccggatgcgggcgctggggctg
aactccgtcgacacctacgtcgcgtggaacttccacgagccgcggcgcggggaggtcgac
ttcaccggctggcgggacgtcgtccggttcgtcgagacggcggcggaggccgggctcaag
gtgatcatccgccccggcccgtacatctgcgcggagtgggacttcggcgggcttcccgcg
tggctgctggagtccgggaacccgccgctgcggtgcagcgaccccgcctacaccgagctg
acgctgcggtggttcgacgagctgctgccgcgcctcgcaccgttgcaggcgacccggggc
ggcccggtgctggcgttccaggtggagaacgagtacggcagctacggcaacgaccagacg
cacctggagcagctcagggcgggcatgctggagcgcggcatcgacagcctgctgttctgc
tccaacggcccttcggactacatgctgcgcggcgggaacctgccggacacgctcgcgacg
gtcaacttcgccggtgatccgacggccccgttcgaggcgctgcgcgagtaccagccggag
ggaccgctgtggtgcaccgagttctgggacggctggttcgaccactggggcgaggagcac
cacacgaccgatccggtcgagaccgcgggccacgtcgaccggatgctggcggccggcgcg
tcggtgtcgctctacatggcggtcggcggcacgaacttcggctggtgggccggtgccaac
tacgacacctccaaggaccagtaccagccgacgatcaccagctacgactacgactccccg
atcggcgaggcaggcgagctgaccgagaagttccagcggatccgcgaggccatcgccagg
cacgcgccggttcccgagccgccgctgcccgcgccgccgcctcggctgcggccgcagacc
gcgcggccggaggcgactaccggactgctggagtcgctcgacgtcctcagctcgccggtg
cgcagcgcgactccggcgcacatggagaagttcggccagccctacggcctgatccactac
cgcaccacggtccaggggccgcgccagacggccggactgcgggtgtccggcctcgccgac
cgcgcgctcgtattcagtgacggcaagtacctcggcgcgctggaccgcaacaccccggac
ctgacgatcgacgtcgccgtgcccggccggaccgggcggctggacctgctcgtagacacc
ggcgggcgggtcaacttcgggcaccagctcagcgacccgaagggcatcaccgaccgggtg
ctgctcggcatgcaggccctgcacggctgggagatccggccgctgccgctggaggacctg
tccgggctgcggttcggcggtgggacgtcggccgggccggtgttccaccgcgcgcggatg
tcgatcgccgaacctgcggacgggttcctggcgcttcccggctgggagaaggggatggtc
tggctcaacggcttcctgctcggccggtactggtcggtcggaccgcaggtcaccctctac
gcgccgagtccgctgtggaagcagggcgagaacgagatcgtggtgctggagatgcacgag
gccgggcaggacatcgaactgcgctccgagcccgacctcggctag

DBGET integrated database retrieval system