KEGG   Saccharopolyspora erythraea: SACE_0363Help
Entry
SACE_0363         CDS       T00492                                 

Gene name
nagA
Definition
beta-N-acetylglucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sen  Saccharopolyspora erythraea
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_0363 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SACE_0363 (nagA)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SACE_0363 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(399346..401079)
Genome map
AA seq 577 aa AA seqDB search
MAVVSASLTAIGNAAPAGDAHSWATRTMRGMTLEEKVGQLFVTYAYGRTADTPHQANRDE
FGVATPAEVVQKYHLGGIIHFNWTDSIYEPKQIAELSNGLQRAAVTSGAKIPLLISTDQE
QGQITRIKEPATQLPGNMALGAGRSPADAERAAVITGQELRAMGLAQNFAPSGDVNVNPA
NPVIGVRSFSSDPALAAELTAAQVRGYQGYGAVTASVKHFPGHGDTNQDSHEELPVIEHD
RQQWEALDAPPFRAAIDAGTDTVMSAHIVVPKLDDSGEPSTLSRNVLTGMLREELGFRGV
VVTDSLQMEGVRHKHPDAEIPVLALEAGADQLLMPQHLQVAIDGVIGAVRSGRLTEKRID
QSVERILRMKAGRGVIDRPFVDVSKVDRIVGSPRNLEAAQKITDRTTTLLRNDAAVLPLR
QPPGRVLVTGAGASPTKALAGSITARGSQATALETGMKPTPQQIDQAVQAAGQNDLTVVL
TNAAWNEANASQRDLVRALQRSGKPVVAVAVRDPYDAAHVDEVPTWLTTYSDKAVAMESL
ARTLFGEIAPVGKLPVPVPDPTRPGTDRYPFGHGLSW
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgtatccgccagcctgaccgccatcggcaacgccgccccggccggtgacgcc
cactcgtgggccactcgcaccatgcgcggcatgacgctggaggagaaggtcggccagctc
ttcgtcacctacgcctacggccgcaccgccgacaccccgcaccaggccaaccgggacgag
ttcggcgtcgccacccccgccgaggtggtgcagaagtaccacctgggcggcatcatccac
ttcaactggacagacagcatctacgagccgaagcagatcgccgagctgtccaacggcctg
cagcgggccgcggtgacctcgggcgcgaagatcccgctgctgatctccaccgaccaggag
cagggccagatcacccggatcaaggagcccgccacgcagctgcccggcaacatggcgctg
ggcgccgggcgctcgcccgccgacgccgagcgcgcggcggtgatcacgggtcaggagctg
cgggcgatgggcctggcgcagaacttcgcgccgagcggcgacgtcaacgtcaaccccgcg
aacccggtcatcggtgtccgctcgttctcctccgaccccgcgctggccgccgagctgacc
gcggcgcaggtccgcggctaccagggctacggcgccgtcaccgcctcggtcaagcacttc
cccggtcacggcgacaccaaccaggacagccacgaggagctgccggtcatcgagcacgac
cgccagcagtgggaggccctcgacgcgccgccgttccgcgccgcgatcgacgcgggcacc
gacaccgtgatgagcgcgcacatcgtcgtgccgaagctcgacgactccggtgagccgtcg
acgctctcgcgcaacgtgctcaccgggatgcttcgcgaggagctgggcttccggggcgtg
gtcgtcaccgactcgctgcagatggagggcgtgcggcacaagcaccccgacgccgagatc
ccggtgctggcgctggaggccggtgccgaccagctgctgatgccgcagcacctgcaggtc
gccatcgacggcgtgatcggcgcggtgcgctccggcaggctcaccgagaagcggatcgac
cagagcgtggagcgcatcctgcggatgaaggcggggcgcggcgtgatcgaccggcccttc
gtcgacgtgtccaaggtggaccggatcgtcgggtcgccgcgcaacctcgaagccgcgcag
aagatcaccgaccgcaccacgacgctgctgcgcaacgacgcggctgtgctgccgttgcgg
cagccaccgggccgggtgctggtgaccggtgcgggcgcgagcccgaccaaggcgctggcg
ggcagcatcaccgcgcgcggttcgcaggcgaccgcgctggagaccggtatgaagccgaca
ccgcagcagatcgaccaggctgtccaggcggccgggcagaacgacctgaccgtggtgctg
accaacgccgcgtggaacgaggccaacgcgtcgcagcgcgacctggtgcgcgcattgcag
cgaagcggtaaaccggtggtggcggtcgcggtccgcgacccctacgacgccgcccacgtg
gacgaggtcccgacctggctgacgacctactcggacaaggcggtggcgatggagtcgctg
gccaggacgctgttcggggagatcgcgccggtcggcaagctgccggtcccggtgcccgac
ccgaccaggccgggaaccgaccgctacccgttcgggcacggtctgagctggtaa

DBGET integrated database retrieval system