KEGG   Saccharopolyspora erythraea: SACE_0400Help
Entry
SACE_0400         CDS       T00492                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SACE_0400 (folK)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SACE_0400 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
449353..449856
Genome map
AA seq 167 aa AA seqDB search
MSRAVLSLGSNLGDRLAHLRLAVEGFSDVLVAASPVYETAPWGVTDQPDFLNAVIVVESA
GVDEWGWLRRGQELERAAERVRERRWGPRTLDVDVVSVDDVRSDDPELLLPHPGTPSRAT
VLIPWHSIDPEAQLPGRGPIAALLAALPEDEVSGVRLRADLDLRPSG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagggcagtgctgtcgttggggtcgaacctcggtgaccggctggcgcacctgcgg
ctggccgtcgagggcttctccgacgtgctggtcgcggcgtcgccggtgtacgagaccgcg
ccctggggtgtgaccgaccagccggacttcctcaacgcggtcatcgtcgtggagtcggcc
ggcgtcgacgagtggggctggctgcggcgcgggcaggagttggagcgcgccgccgagcgc
gtgcgggagcggcgctggggcccgcggacgctggacgtggacgtggtgtcggtcgacgac
gtccgcagcgacgacccggagctgctgctgccgcaccccggcacgcccagccgggcgacc
gtgctgatcccgtggcactcgatcgacccggaggcgcagcttcctggtcgcggtccgatc
gcggcgctgctcgcggcgctgccggaggacgaggtgtccggggtccggctgcgcgccgac
ctggatctgcggccgtcaggctga

DBGET integrated database retrieval system