KEGG   Saccharopolyspora erythraea: SACE_0644Help
Entry
SACE_0644         CDS       T00492                                 

Gene name
yihR
Definition
(GenBank) predicted aldose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00052  Galactose metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
Module
sen_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_0644 (yihR)
   00052 Galactose metabolism
    SACE_0644 (yihR)
Enzymes [BR:sen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SACE_0644 (yihR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CAL99989
Cambridge: SACE_0644
Kitasato: SACE_0644
UniProt: A4F7G5
Position
706977..707903
Genome map
AA seq 308 aa AA seqDB search
MNDPVPATGRQFEIAHGAARAVVTEVGAALRAFEVGGVPYSETYGPDEQPPSAAGAVLVP
WPNRVADGHWTLDGEPQQLALSEPARHNAIHGLLRHAPWRLVEHAESTVVLHAMVVAQPG
WPVPLLTSIGYTLDDDGLTVTHTVENLGARATPFGVGVHPYPRAGHAETDDCVLRLAASS
VLPVDPERLLPTRPPRALQGDEIEFRTGRRLAGVLLDTAFGGAAPAPDDPRERIRHTLTD
PTGHGVELWADPVFKWVQVYTADDFPGRGRAVAIEPMTCPPAALNSGEDLLVLQPGETWI
ASWGLRPL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgatccagttcccgccaccggccggcagttcgagatcgcccatggcgccgcgcgg
gccgtcgtcaccgaggtcggcgcggcgcttcgcgcgttcgaggtcggcggggtgccgtac
tcggagacctacgggcccgacgagcagccgccgtcggcggctggcgcggtgctggtgccg
tggccgaaccgggtcgccgacgggcactggacgctggacggcgagccgcagcagctcgcg
ctctccgagcccgcgcggcacaacgccatccacggcctgctgcggcacgcgccgtggcgg
ctcgtcgagcacgccgagtccacggtcgtgctgcacgcgatggtggtggcacagccgggc
tggccggtgccgctgctgacctccatcggctacaccctcgacgacgacgggctcaccgtc
acccacaccgtggagaacctcggcgcccgagccacgcccttcggcgtcggcgtgcacccc
tacccgagggcggggcacgcggagaccgacgactgcgtcctgcggctggcggcttccagc
gtcctgccggtcgacccggagcggctgcttccgacccggccaccgagggcgctgcagggc
gacgagatcgagttccgcaccggtcgcaggctcgcgggtgtcctgctcgacaccgccttc
ggcggcgccgcgcccgccccggacgacccgcgagaacgcatccgccacaccctcaccgac
cccaccggccacggcgtcgagctgtgggcggatccggtgttcaagtgggtgcaggtctac
accgccgacgacttccccgggcggggccgcgcggtcgccatcgagccgatgacctgcccc
ccggccgctctcaactcgggggaggacctgctcgtcctccagcccggcgaaacctggatc
gcctcctggggcctccgccctctctga

DBGET integrated database retrieval system