KEGG   Saccharopolyspora erythraea: SACE_0714Help
Entry
SACE_0714         CDS       T00492                                 

Gene name
eryBVII
Definition
(GenBank) dTDP-4-deoxyglucose 3,5-epimerase (EC:5.1.3.13)
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
sen  Saccharopolyspora erythraea
Pathway
Staurosporine biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Module
dTDP-L-mycarose biosynthesis
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SACE_0714 (eryBVII)
   01055 Biosynthesis of vancomycin group antibiotics
    SACE_0714 (eryBVII)
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    SACE_0714 (eryBVII)
Enzymes [BR:sen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     SACE_0714 (eryBVII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(779802..780404)
Genome map
AA seq 200 aa AA seqDB search
MRVRELAVAGGFEFTPDPKQDRRGLFVSPLQDEAFVGAVGHRFPVAQMNHIVSARGVLRG
LHFTTTPPGQCKYVYCARGRALDVIVDIRVGSPTFGKWDAVEMDTEHFRAVYFPRGTAHA
FLALEDDTLMSYLVSTPYVAEYEQAIDPFDPALGLPWPADLEVVLSDRDTVAVDLETARR
RGMLPDYADCLGEEPASTGR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagtacgtgagctggcggtggcgggcggtttcgagttcacccccgacccgaagcag
gaccggcggggcctgttcgtgtctccgctgcaggacgaggcgttcgtgggcgcggtgggc
catcggttccccgtcgcccagatgaaccacatcgtctccgcccggggcgtgctgcgcggg
ctgcacttcaccaccaccccgccggggcagtgcaagtacgtctactgcgcgcgcggccgg
gcgctcgacgtcatcgtcgacatccgggtcggctcgccgacgttcgggaagtgggacgcg
gtggagatggacaccgagcacttccgggcggtctacttccccaggggcaccgcgcacgcc
ttcctcgcgcttgaggacgacaccctgatgtcgtacctggtcagcacgccgtacgtggcc
gagtacgagcaggcgatcgacccgttcgaccccgcgctgggtctgccgtggcccgcggac
ctggaggtcgtgctctccgaccgcgacacggtggccgtggacctggagaccgccaggcgg
cgagggatgctgcccgactacgccgactgcctcggcgaggagcccgccagcaccggcagg
tga

DBGET integrated database retrieval system