KEGG   Saccharopolyspora erythraea: SACE_0714Help
Entry
SACE_0714         CDS       T00492                                 

Gene name
eryBVII
Definition
dTDP-4-deoxyglucose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sen  Saccharopolyspora erythraea
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:sen00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sen00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(779802..780404)
Genome map
AA seq 200 aa AA seqDB search
MRVRELAVAGGFEFTPDPKQDRRGLFVSPLQDEAFVGAVGHRFPVAQMNHIVSARGVLRG
LHFTTTPPGQCKYVYCARGRALDVIVDIRVGSPTFGKWDAVEMDTEHFRAVYFPRGTAHA
FLALEDDTLMSYLVSTPYVAEYEQAIDPFDPALGLPWPADLEVVLSDRDTVAVDLETARR
RGMLPDYADCLGEEPASTGR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagtacgtgagctggcggtggcgggcggtttcgagttcacccccgacccgaagcag
gaccggcggggcctgttcgtgtctccgctgcaggacgaggcgttcgtgggcgcggtgggc
catcggttccccgtcgcccagatgaaccacatcgtctccgcccggggcgtgctgcgcggg
ctgcacttcaccaccaccccgccggggcagtgcaagtacgtctactgcgcgcgcggccgg
gcgctcgacgtcatcgtcgacatccgggtcggctcgccgacgttcgggaagtgggacgcg
gtggagatggacaccgagcacttccgggcggtctacttccccaggggcaccgcgcacgcc
ttcctcgcgcttgaggacgacaccctgatgtcgtacctggtcagcacgccgtacgtggcc
gagtacgagcaggcgatcgacccgttcgaccccgcgctgggtctgccgtggcccgcggac
ctggaggtcgtgctctccgaccgcgacacggtggccgtggacctggagaccgccaggcgg
cgagggatgctgcccgactacgccgactgcctcggcgaggagcccgccagcaccggcagg
tga

DBGET integrated database retrieval system