KEGG   Saccharopolyspora erythraea: SACE_0774Help
Entry
SACE_0774         CDS       T00492                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sen  Saccharopolyspora erythraea
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SACE_0774 (galU)
   00052 Galactose metabolism
    SACE_0774 (galU)
   00500 Starch and sucrose metabolism
    SACE_0774 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_0774 (galU)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SACE_0774 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
864155..865060
Genome map
AA seq 301 aa AA seqDB search
MDSPTLTAAAAFRTAIVPAAGLGTRFLPTTKAVPKELLPVVDTPAIELVAAEAAEAGASR
LVIVTSPEKESVTEYFRPNPELEQTLSERGKADLLAKVRRAPGLIEAETAIQEKALGLGH
AVSCAESKLTEQDDAVAVLLPDDLVLPTGVLTRMAETRARYGGSVLCAFDVPREQISAYG
IFEVADTGEEDVHRVLGMVEKPAPEDAPSTFAAAGRYLLDRAVFDALQRIEPGAGGELQL
TDAVALLISEGHPVHVVLHRGGRHDLGNPGGFLRAAVDFALQDHEYGPGLRNWLVERLNR
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggacagcccgacgctcaccgcggccgcagcgttccggaccgccatcgttcccgccgcc
ggactcggaaccagattcctgcccacgacgaaggcggttccgaaggaactcctgccggtg
gtcgacacccccgccatcgaactggtcgccgccgaggccgccgaggccggcgcgagcagg
ctggtcatcgtcacctcaccggagaaggagtccgtcaccgagtacttccgcccgaacccg
gagctggagcagaccctgtccgagcggggcaaggcggacctgctcgccaaggtccggcga
gcgccgggcctgatcgaggcggagaccgcgatccaggagaaggcgctcggtctcgggcac
gccgtgtcctgcgccgagtcgaagctgaccgagcaggacgacgccgtcgcggtcctgctg
cccgacgacctggtgctgcccacgggcgtgctcacccggatggccgagacccgcgcccgc
tacggcggcagcgtgctgtgcgcattcgacgtgccgagggagcagatctcggcctacggc
atcttcgaggtggccgacaccggcgaggaggacgtgcacagggtcctgggcatggtcgag
aagcccgctcccgaggatgcgccttcgaccttcgccgccgccgggcgctacctgctcgac
cgggcggtgttcgacgcgttgcagcgcatcgaacccggcgccggaggtgaactgcagctg
accgatgccgtagcgttgctgatctccgaaggtcacccggtccacgtcgtgctgcatcga
ggcgggcgacacgacctgggaaatcctggcggtttcctaagggctgcggtggacttcgcg
ctgcaggatcacgagtacgggccggggctgcggaactggctcgtcgagaggttgaacagg
gagtag

DBGET integrated database retrieval system