KEGG   Saccharopolyspora erythraea: SACE_0819Help
Entry
SACE_0819         CDS       T00492                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sen01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sen01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
915993..916961
Genome map
AA seq 322 aa AA seqDB search
MTAATESVAQEAPSAESGPKPLTAGSRPWIGQLSVYLFVLVPFAALIAAIPFAWGWGLGW
VDVSLALVFYAISGLGVTVGFHRYFTHGSFKTNRGVKIALAISGMMAVQGPAITWVADHR
RHHAYSDRDGDPHSPWRFGSSPAALAKGFWHAHMGWLFERDLTNEDRFAPDLLKDGELVR
INRLFPLWTVASLVLPAVIGGLVTWSPWGAFTAFFWAGLVRVSFLHHITWSVNSICHMIG
ERPFKSRDRAANFWPLAILSFGESWHNSHHADPTCARHGVLRGQLDISARIIWFFEKVGW
AWKVRWPNDKRLARIAVTDYKG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcaaccgagagcgttgcccaagaggcgcccagcgccgagtccggaccgaaa
ccgctcacagcgggaagccgcccctggatcgggcagttgtcggtgtacctgttcgtcctg
gttcccttcgccgcgctgatcgcggcgatccccttcgcctggggctggggactgggatgg
gtggacgtctcgctggcgctggtgttctacgcgatcagcggcctgggagtcaccgtcggc
ttccaccggtacttcacgcacggctccttcaagaccaaccgcggcgtcaagatcgcactc
gcgatctcgggcatgatggccgtccaggggccggcgatcacctgggtcgccgaccaccgc
aggcaccacgcctactccgaccgcgacggcgacccgcactcgccgtggcgcttcggcagc
tcgcccgccgcgctggccaagggcttctggcacgcccacatgggctggctgttcgagcgg
gacctgaccaacgaggaccgcttcgccccggacctgctcaaggacggggaactggtccgc
atcaaccggctgttcccgctgtggaccgtcgccagcctcgtgctgcccgccgtcatcggc
ggcctggtcacctggtcgccgtggggcgcgttcaccgccttcttctgggcgggcctggtg
cgagtgtcgttcctgcaccacatcacgtggtcggtgaactcgatctgccacatgatcggc
gagcggccgttcaagagccgcgaccgcgcggcgaacttctggccgctggcgatcctgtcg
ttcggcgagtcctggcacaactcccaccacgccgacccgacctgcgcgcgccacggcgtg
ctgcgcggccagctcgacatctcggcgcggatcatctggttcttcgagaaggtcggctgg
gcctggaaggtgcgctggccgaacgacaagcggctcgcgcggatcgcggtgaccgactac
aagggctga

DBGET integrated database retrieval system