KEGG   Saccharopolyspora erythraea: SACE_0819Help
Entry
SACE_0819         CDS       T00492                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SACE_0819
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    SACE_0819
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     SACE_0819
Lipid biosynthesis proteins [BR:sen01004]
 Desaturase
  First
   SACE_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
915993..916961
Genome map
AA seq 322 aa AA seqDB search
MTAATESVAQEAPSAESGPKPLTAGSRPWIGQLSVYLFVLVPFAALIAAIPFAWGWGLGW
VDVSLALVFYAISGLGVTVGFHRYFTHGSFKTNRGVKIALAISGMMAVQGPAITWVADHR
RHHAYSDRDGDPHSPWRFGSSPAALAKGFWHAHMGWLFERDLTNEDRFAPDLLKDGELVR
INRLFPLWTVASLVLPAVIGGLVTWSPWGAFTAFFWAGLVRVSFLHHITWSVNSICHMIG
ERPFKSRDRAANFWPLAILSFGESWHNSHHADPTCARHGVLRGQLDISARIIWFFEKVGW
AWKVRWPNDKRLARIAVTDYKG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagcaaccgagagcgttgcccaagaggcgcccagcgccgagtccggaccgaaa
ccgctcacagcgggaagccgcccctggatcgggcagttgtcggtgtacctgttcgtcctg
gttcccttcgccgcgctgatcgcggcgatccccttcgcctggggctggggactgggatgg
gtggacgtctcgctggcgctggtgttctacgcgatcagcggcctgggagtcaccgtcggc
ttccaccggtacttcacgcacggctccttcaagaccaaccgcggcgtcaagatcgcactc
gcgatctcgggcatgatggccgtccaggggccggcgatcacctgggtcgccgaccaccgc
aggcaccacgcctactccgaccgcgacggcgacccgcactcgccgtggcgcttcggcagc
tcgcccgccgcgctggccaagggcttctggcacgcccacatgggctggctgttcgagcgg
gacctgaccaacgaggaccgcttcgccccggacctgctcaaggacggggaactggtccgc
atcaaccggctgttcccgctgtggaccgtcgccagcctcgtgctgcccgccgtcatcggc
ggcctggtcacctggtcgccgtggggcgcgttcaccgccttcttctgggcgggcctggtg
cgagtgtcgttcctgcaccacatcacgtggtcggtgaactcgatctgccacatgatcggc
gagcggccgttcaagagccgcgaccgcgcggcgaacttctggccgctggcgatcctgtcg
ttcggcgagtcctggcacaactcccaccacgccgacccgacctgcgcgcgccacggcgtg
ctgcgcggccagctcgacatctcggcgcggatcatctggttcttcgagaaggtcggctgg
gcctggaaggtgcgctggccgaacgacaagcggctcgcgcggatcgcggtgaccgactac
aagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system