KEGG   Saccharopolyspora erythraea: SACE_0948Help
Entry
SACE_0948         CDS       T00492                                 

Definition
L-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SACE_0948
Enzymes [BR:sen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     SACE_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1061552..1062967
Genome map
AA seq 471 aa AA seqDB search
MARIGVISISDGRDHVHARNSEFIQSKQDELVRSLKQAGHEVVVGDDLVATNTLATSVAR
KVAASEVDVTVFYYAVWAFPHFTMLAADATRSPLVLVASTDPTEPGLVGMLAAGGALDQI
GRSHTRAWGAPDDTELAEKISVHARAAAAVSALHGSTFGRFGGRPMGMNTAVANTDQWQR
QFGIDVEEIDQYELVLRAEKADEAEAKHAREWIERHAAGVHYDGKKLTPELLERQIRSYM
AVRDIIAERNLDFSGIKGQPELTEHFATMDVTEAFLNDPYDWNGPKKTHVCATEADMDGA
LTMQIFKSIAETPVLFADVRHYHADRDIWDLCNSGQHATWFAARSDDPAENLAKVNFYPE
VFFFPAGGASVQHIAAPGQMTLGRLTREDGQYRLQLMLGEFESYDEATNKVLMDQSTPEW
PHAFARLDAPGEVFLSKFGANHIHAIPGDHRAALRAVTEQLGIRLDEWTRG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtggctcgcatcggtgtcatcagcatctccgacgggcgtgaccatgtgcacgcgcggaac
tcggagttcatccagtccaagcaggacgaactcgtccggtcgctgaagcaggccgggcac
gaggtcgtcgtgggcgacgacctggtcgccaccaacaccctggccacctcggtggcgcgc
aaggtcgccgcctccgaggtcgacgtcaccgtcttctactacgcagtctgggccttcccg
cacttcacgatgctggcagccgacgcaacccgcagcccgctggtgctggtcgccagcacc
gaccccaccgagcccggcctggtcggcatgctcgcggcgggcggcgcgctcgaccagatc
ggccgctcgcacacccgggcgtggggcgctccggacgacaccgagctggcggagaagatc
agcgtgcacgccagggcggcggccgcggtctcggccctgcacggctccaccttcggccgc
ttcggcggccgtccgatgggcatgaacaccgcggtggccaacaccgaccagtggcagcgc
cagttcggcatcgacgtcgaggagatcgaccagtacgagctggtcctgcgcgcggagaag
gccgacgaggccgaggccaagcacgcccgcgagtggatcgagcgccacgccgccggggtg
cactacgacggcaagaagctcaccccggagctgctggagcgccagatccgctcctacatg
gcggtccgggacatcatcgccgagcgcaacctggacttctccggcatcaagggccagccc
gagctcaccgagcacttcgccaccatggacgtcaccgaggcgttcctcaacgacccctac
gactggaacggtccgaagaagacccacgtctgcgccaccgaggccgacatggacggggcg
ctgacgatgcagatcttcaagagcatcgccgagaccccggtcctgttcgccgacgtccgc
cactaccacgccgaccgcgacatctgggacctgtgcaactccggccagcacgccacctgg
ttcgccgcgcgcagcgacgacccggcggagaacctggcgaaggtcaacttctacccggag
gtgttcttcttcccggcgggcggcgcctcggtccagcacatcgccgctcccggccagatg
acgctcggcaggctgacgcgcgaggacggccagtaccggctccagctcatgctcggcgag
ttcgagagctacgacgaggccaccaacaaggtgctgatggaccagtcgacgccggagtgg
ccgcacgccttcgcacggctcgacgcgccgggcgaggtgttcctgtcgaagttcggcgcc
aaccacatccacgccatcccgggcgaccaccgcgccgcgctgcgcgccgtcaccgagcag
ctcggtatccgtctcgacgagtggacccgcggctga

DBGET integrated database retrieval system