KEGG   Saccharopolyspora erythraea: SACE_0979Help
Entry
SACE_0979         CDS       T00492                                 

Gene name
aao
Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sen00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sen00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:sen00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:sen00311]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1092002..1092940
Genome map
AA seq 312 aa AA seqDB search
MLVIGAGVQGLTSGIVLAEAGVPVRIRTAERPRDTTSAVAGAMWGPAMLRPADRVLRWVT
RSYAEFTALCRDSASGVHLAPGRMAARFDLGDVVPPEAHLLDDLRKCTPDELPEGFVSGY
HATVPLIDMPKYLDHLVDRFRAAGGELVVSPVPTLGEAVAEARVVVNCTGVGARELVGDP
AVHPVRGQHVVVANPGVQEYFIELTTDSEFTGYMPHGDRVVLGGVAVEHDWNLVPSRTVS
EGILRRCAEVEPKLDGAEVRDEIVGLRPGREQVRLEVEHFEGSRIVHDYGHAGCGVALSW
GCAFEVADLVGA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgtcatcggagccggggtgcagggtctgacctcgggaatcgtcctcgccgaagcc
ggggtgccggtccgcatccgcaccgccgagcgtccccgcgacaccacctccgccgtcgcg
ggcgccatgtggggaccggcgatgctccggccggccgaccgcgtcctgcgatgggtcacc
cgctcgtatgcggagttcacggcgctgtgccgcgacagcgcgtcgggcgtgcacctggca
ccgggccggatggcggcccgcttcgacctgggcgacgtcgtcccgccggaagcgcatctc
ctcgacgacctgcgcaaatgcacgcccgacgagctaccggagggcttcgtcagcggctac
cacgccaccgtgccgctcatcgacatgccgaagtacctggaccacctcgtcgaccgcttc
cgggccgcgggcggcgaactggtggtcagcccggtgccgacgctgggcgaggcggtcgcc
gaggcgcgggtcgtggtgaactgcaccggcgtcggggcccgcgagctggtcggcgacccc
gccgtgcacccggtgcgcggccagcacgtggtggtggccaacccgggcgtgcaggagtac
ttcatcgagctgaccacggactccgagttcaccggctacatgccgcacggcgaccgggtg
gtgctcggcggcgtggcggtggagcacgactggaacctggtgccgtcccgcacggtgagc
gagggcatcctgcgccgctgcgcggaggtcgaaccgaagctcgacggcgccgaggtccga
gacgagatcgtcggactgcgccccgggcgcgagcaggtccggctggaggtcgagcacttc
gagggctcgcggatcgtgcacgactacggccacgccgggtgcggggtcgccctgtcctgg
ggctgcgccttcgaggtcgccgacctcgtcggagcctga

DBGET integrated database retrieval system