KEGG   Saccharopolyspora erythraea: SACE_1018Help
Entry
SACE_1018         CDS       T00492                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase (SDAP)
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00300  Lysine biosynthesis
sen01100  Metabolic pathways
sen01120  Microbial metabolism in diverse environments
sen01230  Biosynthesis of amino acids
Module
sen_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SACE_1018 (dapE)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SACE_1018 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAM00350
Cambridge: SACE_1018
Kitasato: SACE_1018
UniProt: A4F8H5
Position
1133528..1134613
Genome map
AA seq 361 aa AA seqDB search
MTAELNLTADPVELTAALVDIPSVSGDEKLIADAVEHALREQAPHLEVIRNGEAVLARTN
LGRGSRVVLAGHLDTVPVNDNLPSHRSGSGDDELLHGCGTTDMKGGDAVMLGIAAGLTDP
RHDLTFLFYDCEEVEAERNGLNRIERELPEWLDGDLAVVLEPSNAAIEAGCQGTLRVEVR
TEGARAHTARAWMGENAIHAAQPILKRLVDYTPRQPTIDGLHFHEGLQAVRIAGGVAGNV
VPDSCVVTVNHRFAPDRSLAEAEAHVREVFDGFEVTLTDGSQGALPGLTAPAAAELVAAS
GQAPVAKLGWTDVARFAARGLPAVNFGPGSPTLAHTQQEHVPVSQIRHCAQALRRFLSQE
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccgagctgaacctcaccgcagatcccgtcgagctcaccgccgccctggtggac
atcccgagcgtctcgggcgacgagaagctcatcgccgacgccgtcgagcacgcgcttcgc
gagcaggcaccgcacctggaggtcatccgcaacggcgaggccgtgctggccaggacgaac
ctcggccgcggctcccgggtggtgctcgccggtcacctggacaccgtgccggtcaacgac
aacctgccgtcgcaccgcagcggctcgggcgacgacgagctgctccacggctgcggcacc
accgacatgaagggcggcgacgcggtgatgctcggcatcgccgccgggctcaccgacccg
cgccacgacctgaccttcctgttctacgactgcgaggaggtcgaggccgagcgcaacggc
ctgaaccgcatcgagcgggagctgccggaatggctcgacggcgacctcgcggtggtcctg
gagccgtcgaacgcggcgatcgaggccgggtgccagggcacgctgcgggtcgaggtccgc
accgagggcgcgcgggcgcacacggcgcgggcgtggatgggcgagaacgccatccacgcg
gcgcagccgatcctcaagcgcctcgtcgactacacgccgaggcagcccacgatcgacggc
ctgcacttccacgaggggctgcaggcggtgcggatcgccggtggcgtcgcgggcaacgtc
gtcccggacagctgcgtggtgacggtgaaccaccgcttcgccccggaccgctccctggcc
gaggcggaggcgcacgtgcgggaggtcttcgacggcttcgaggtgaccctgaccgacggg
tcgcagggcgcgctgccggggctcacggcccccgcggcggcggaactggtcgcggcgtcc
ggtcaggcgccggtggcgaagctggggtggaccgacgtcgcgcggttcgcagcgcgcggg
ctgcccgcggtgaacttcggccctggctccccgacgctggcccacacgcagcaggaacac
gtgcctgtgtcgcagatccgccactgcgcccaggccctgcgccgcttcctcagccaggag
ggctga

DBGET integrated database retrieval system