KEGG   Saccharopolyspora erythraea: SACE_1074Help
Entry
SACE_1074         CDS       T00492                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACE_1074
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     SACE_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1189013..1189858
Genome map
AA seq 281 aa AA seqDB search
MCDDVGVHDEQQPLTGFTVGVTAERKAEEIGGLLSRRGARVLYGAAMHTVPLPEDGELAS
ATSEVLSAPVDIAIAITGVGFRGWLEAAEANGVRDRLVEHLRSATLLARGAKAKGAIRGA
GLLEEWTSPAEESAEVLDHLLARGVSGARIVLQVHGDPMLRFQSELRDAGAEVVPVTVYR
WTDPLDLPALDDLIDAVLAGEVDALPFTSAPAATNLLNRADRTGRGGRFRELLREKVLIA
CVGPVTAAPIAAAGLPYVMPDRARTGALVRLVAEELPKLGR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgacgatgtcggggtgcatgacgagcaacaacccctgaccggcttcaccgtgggg
gtcaccgcggaacgcaaggccgaggagatcggcgggctgctgtcccgccgcggtgcccgc
gtcctgtacggggccgccatgcacacggtgccgctgcccgaggacggcgagctcgcctcg
gccaccagcgaggtgctgtcggcgccggtcgacatcgcgatcgccatcaccggcgtcggt
ttccggggctggctggaggccgccgaggccaacggcgtgcgcgaccggctcgtcgagcac
ctgcggtcggcgacgctgctggcgcgcggggccaaggccaagggcgcgatccgcggcgcc
gggctgctcgaggagtggacgtccccggcggaggagtcggccgaggtgctcgaccacctg
ctggcccggggcgtctcgggcgcccggatcgtcctgcaggtccacggcgacccgatgctg
cgcttccagtcggagctgcgcgacgcgggcgcggaggtcgtaccggtcaccgtgtaccgc
tggaccgacccgctcgacctgcccgcgctggacgacctgatcgacgcggtgctggcgggc
gaggtcgacgcgctgccgttcaccagcgccccggccgcgacgaacctgctcaaccgggcc
gaccgcaccgggcgcggcgggcggttccgcgagctgctgcgggagaaggtgctcatcgcc
tgcgtcggtccggtgaccgcggccccgatcgctgccgcgggcctgccctacgtgatgccc
gaccgggcgcgcaccggggcactggtgcggctggtcgccgaggaactgccgaagctgggc
cgctga

DBGET integrated database retrieval system