KEGG   Saccharopolyspora erythraea: SACE_1433Help
Entry
SACE_1433         CDS       T00492                                 

Definition
(GenBank) probable phosphoglycerate mutase (phosphoglyceromutase)
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
sen  Saccharopolyspora erythraea
Brite
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     SACE_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAM00755
Cambridge: SACE_1433
Kitasato: SACE_1433
UniProt: A4F9N0
Position
1582107..1582721
Genome map
AA seq 204 aa AA seqDB search
MTLDRLLLWRHGETDYNAAGRIQGHLDSSLTETGQEQARRAAPVIAAFQPDVALSSDLNR
ARSTAAEFTEVSGMPVRLDKRLRETHLGEWQGLSGAEVEHGWPGAMSTWRSTPTWAPPGG
ESRVEVAERALEVVDELDLTYTGTALLCAHGGLITALTARLLSWPVELWPGLGGVANCHW
VVLARRSSSDHRWRLMTYNGGVAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggacaggctgctgctctggaggcacggcgagaccgactacaacgcggccggc
cgtatccagggccacctcgacagctcgctgaccgagaccggacaggagcaggccaggcgc
gccgcgccggtgatcgccgccttccagcccgacgtcgcgctcagctcggacctcaaccgg
gccaggtcgaccgctgccgagttcaccgaggtcagcggcatgccggtgcgcctggacaag
cgcctgcgggaaacccacctcggggagtggcaggggctgagcggagccgaggtcgaacac
ggctggccgggcgcgatgagcacttggcgctcgacgccgacctgggccccgccgggcggc
gagtccagggtcgaggtcgccgagcgggcgttggaggtcgtcgacgagctcgacctcacc
tacaccggtaccgcgctgctgtgcgcgcacggcggtctgatcaccgcgctcaccgcccgg
ttgctgtcgtggccggtggagctctggccgggtctgggcggtgtcgcgaactgccactgg
gtcgtcctcgcgcggcgcagcagcagcgaccaccgctggcggctgatgacctacaacggc
ggcgtcgccggatga

DBGET integrated database retrieval system