KEGG   Saccharopolyspora erythraea: SACE_1433Help
Entry
SACE_1433         CDS       T00492                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_1433
   01230 Biosynthesis of amino acids
    SACE_1433
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_1433
  Energy metabolism
   00680 Methane metabolism
    SACE_1433
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_1433
Enzymes [BR:sen01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SACE_1433
Exosome [BR:sen04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SACE_1433
  Exosomal proteins of melanoma cells
   SACE_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1582107..1582721
Genome map
AA seq 204 aa AA seqDB search
MTLDRLLLWRHGETDYNAAGRIQGHLDSSLTETGQEQARRAAPVIAAFQPDVALSSDLNR
ARSTAAEFTEVSGMPVRLDKRLRETHLGEWQGLSGAEVEHGWPGAMSTWRSTPTWAPPGG
ESRVEVAERALEVVDELDLTYTGTALLCAHGGLITALTARLLSWPVELWPGLGGVANCHW
VVLARRSSSDHRWRLMTYNGGVAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggacaggctgctgctctggaggcacggcgagaccgactacaacgcggccggc
cgtatccagggccacctcgacagctcgctgaccgagaccggacaggagcaggccaggcgc
gccgcgccggtgatcgccgccttccagcccgacgtcgcgctcagctcggacctcaaccgg
gccaggtcgaccgctgccgagttcaccgaggtcagcggcatgccggtgcgcctggacaag
cgcctgcgggaaacccacctcggggagtggcaggggctgagcggagccgaggtcgaacac
ggctggccgggcgcgatgagcacttggcgctcgacgccgacctgggccccgccgggcggc
gagtccagggtcgaggtcgccgagcgggcgttggaggtcgtcgacgagctcgacctcacc
tacaccggtaccgcgctgctgtgcgcgcacggcggtctgatcaccgcgctcaccgcccgg
ttgctgtcgtggccggtggagctctggccgggtctgggcggtgtcgcgaactgccactgg
gtcgtcctcgcgcggcgcagcagcagcgaccaccgctggcggctgatgacctacaacggc
ggcgtcgccggatga

DBGET integrated database retrieval system