KEGG   Saccharopolyspora erythraea: SACE_1437Help
Entry
SACE_1437         CDS       T00492                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SACE_1437
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SACE_1437
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SACE_1437
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SACE_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(1587682..1588953)
Genome map
AA seq 423 aa AA seqDB search
MTAAAHAQTTGAKTTYDLGNAVELVSKEEGHRQPLAPEFVSLEDFSPLEVAYDFGRIRRE
DIEAGPRSIWRYKQLLPVPSNVDEHPNTEPGCTRLVRADRLAKALGVKQIWIKDDTGNPT
HSFKDRVVAVALAAAREFGFKVLACPSTGNLANAVAAAAARAGWDSVVLVPSTLERAKIL
MSAVYDGSLLAVDGNYDDVNRLATELAAEHEDWAFVNVNVRPYYSEGSKTLAFEVAEQLG
WRIPEQIVVPIASGSQLTKVDKGFRELTQVGLVEDSPVRIFGAQATGCSPVASAFKEGHD
VVQPVRPDTIARSLAIGAPADGPYVLDVVRRTNGAIEDVTDEEVVEGIRLLARTEGIFAE
TAGGVTVATAKKLIEAGKIDPDQETVLLITGDGLKTLDAVQDKVGPKATVAPSTEAVNAA
LGL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgccgcccatgcccagacgaccggcgcgaagacgacctacgacctcggcaac
gccgtcgaactggtgtccaaggaagagggccaccggcagccgctggctccggagttcgtc
tcgctggaggacttctcgccactggaggtcgcctacgacttcgggcgcatccgccgcgag
gacatcgaagccgggccccgctcgatctggcgctacaagcagttgctccccgttccgtcc
aacgtggacgagcacccgaacaccgagcccggctgtacccggctggtgcgtgctgaccgg
ctcgcgaaggcgctgggcgtcaagcagatctggatcaaggacgacaccggcaaccccacc
cactccttcaaggaccgcgtggtcgcggtggcgctggccgccgcccgcgagttcggcttc
aaggtcctcgcctgcccctccaccggcaacctcgccaacgccgtcgccgccgccgcggcc
cgcgccggctgggactcggtggtgctggtcccgtccacgctcgagcgcgccaagatcctg
atgagcgcggtctacgacggctcgctgctcgcggtggacggcaactacgacgacgtgaac
cggctggcgaccgagctcgccgccgagcacgaggactgggcgttcgtcaacgtcaacgtc
cggccgtactactccgagggctccaagacgctggccttcgaggtcgccgagcagctcgga
tggcgcatcccggagcagatcgtggtcccgatcgcctccggctcccagctcaccaaggtc
gacaagggcttccgcgagctcacccaggtcggcctcgtcgaggacagcccggtccgcatc
ttcggcgcccaggccaccggctgctccccggtcgcctcggcgttcaaggagggccacgac
gtggtgcagccggtccgcccggacaccatcgcgcgctccctggccatcggcgccccggcc
gacggcccctacgtgctcgacgtcgtgcgccgcaccaacggcgccatcgaggacgtcacc
gacgaagaggtcgtcgagggcatccggctgctggcccgcaccgaggggatcttcgccgag
accgccggcggcgtcaccgtggcgacggcgaagaagctcatcgaggccggcaagatcgac
ccggaccaggagaccgtgctgctgatcaccggcgacggcctcaagaccctcgacgcggtg
caggacaaggtcggcccgaaggcgaccgtcgccccgagcaccgaggcggtcaacgccgcg
ctgggcctctga

DBGET integrated database retrieval system