KEGG   Saccharopolyspora erythraea: SACE_1449Help
Entry
SACE_1449         CDS       T00492                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_1449 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SACE_1449 (aceA)
Enzymes [BR:sen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SACE_1449 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1599411..1600718
Genome map
AA seq 435 aa AA seqDB search
MSSIRERAIKAAEELQREWDTDPRWKGIERTYSAGDVIRLRGSVREEHTLARQGAERLWK
LLHENDYINSLGALTGNQAVQQIRAGLKAIYLSGWQVAADANLAGETYPDQSLYPANSVP
AVVRRINNALRRADQINWAEALDPEADEPENIHWLAPIVADAEAGFGGTLNAYELMKGMI
AAGAAGVHWEDQLASEKKCGHLGGKVLIPTSQHVKTLNAARLAADVAGVPSLVVARTDAQ
AATLLTSDVDERDQKFITGERTSEGFYKVTNGIEPCITRGLAYAPHADLIWMETSKPDLE
VAKQFAEAIKAQYPDQMLAYNCSPSFNWKKNLDDSTIAKFQRELGHMGYKFQFITLAGFH
SLNYSMFDLAKGYAHDGMTSYVDLQEREFAAEKDGYTATRHQREAGTGYFDLVSTAISPD
SSTTALAGSTETAQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatccgcgagagggcgatcaaggccgccgaggaacttcagcgcgagtgggac
accgaccctcgttggaagggcatcgagcgcacctactccgccggtgacgtcatccgcctc
cgcgggtcggtgagggaagagcacacgctggcccgccagggcgccgagcggctgtggaag
ctgctccacgagaacgactacatcaactccctcggcgcgctgaccggcaaccaggccgtc
cagcagatccgggcgggtctgaaggccatctacctgtccggctggcaggtcgccgccgac
gccaacctggcgggcgagacctaccccgaccagagcctctacccggccaactcggtccct
gccgtggtccgccgcatcaacaacgcgctgcggcgcgccgaccagatcaactgggccgag
gcgctggacccggaggccgacgagccggagaacatccactggctggccccgatcgtggcc
gacgccgaggccggcttcggcggcacgctcaacgcctacgagctgatgaagggcatgatc
gccgccggtgcggccggtgtgcactgggaggaccagcttgcctccgagaagaagtgcggc
cacctgggcggcaaggtcctcatcccgaccagccagcacgtcaagacgctgaacgcggcc
cggctggccgccgacgtcgcaggcgtgccctcgctggtcgtcgcgcgcaccgacgcgcag
gccgcgacgctgctgaccagcgacgtcgacgagcgcgaccagaagttcatcaccggtgag
cgcacctcggagggcttctacaaggtcaccaacggcatcgagccctgcatcacccgcggt
ctggcctacgcgccgcacgcggacctgatctggatggagacctcgaagccggacctggag
gtcgccaagcagttcgccgaggcgatcaaggcccagtacccggaccagatgctggcctac
aactgctcgccgtcgttcaactggaagaagaacctggacgacagcaccatcgccaagttc
cagcgcgagctcggccacatgggctacaagttccagttcatcaccctggcgggcttccac
tcgctgaactacagcatgttcgacctggccaagggctacgcgcacgacggcatgacctcc
tacgtggacctgcaggagcgcgagttcgccgcggagaaggacggctacaccgcgacccgt
caccagcgcgaggccggtaccggctacttcgacctggtcagcaccgcgatcagcccggac
tcctcgaccaccgccctggcgggttcgaccgagaccgcgcagttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system