KEGG   Saccharopolyspora erythraea: SACE_1449Help
Entry
SACE_1449         CDS       T00492                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00630  Glyoxylate and dicarboxylate metabolism
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01200  Carbon metabolism
Module
sen_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SACE_1449 (aceA)
Enzymes [BR:sen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SACE_1449 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase DUF3338
Motif
Other DBs
NCBI-ProteinID: CAM00771
Cambridge: SACE_1449
Kitasato: SACE_1449
UniProt: A4F9P6
Position
1599411..1600718
Genome map
AA seq 435 aa AA seqDB search
MSSIRERAIKAAEELQREWDTDPRWKGIERTYSAGDVIRLRGSVREEHTLARQGAERLWK
LLHENDYINSLGALTGNQAVQQIRAGLKAIYLSGWQVAADANLAGETYPDQSLYPANSVP
AVVRRINNALRRADQINWAEALDPEADEPENIHWLAPIVADAEAGFGGTLNAYELMKGMI
AAGAAGVHWEDQLASEKKCGHLGGKVLIPTSQHVKTLNAARLAADVAGVPSLVVARTDAQ
AATLLTSDVDERDQKFITGERTSEGFYKVTNGIEPCITRGLAYAPHADLIWMETSKPDLE
VAKQFAEAIKAQYPDQMLAYNCSPSFNWKKNLDDSTIAKFQRELGHMGYKFQFITLAGFH
SLNYSMFDLAKGYAHDGMTSYVDLQEREFAAEKDGYTATRHQREAGTGYFDLVSTAISPD
SSTTALAGSTETAQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatccgcgagagggcgatcaaggccgccgaggaacttcagcgcgagtgggac
accgaccctcgttggaagggcatcgagcgcacctactccgccggtgacgtcatccgcctc
cgcgggtcggtgagggaagagcacacgctggcccgccagggcgccgagcggctgtggaag
ctgctccacgagaacgactacatcaactccctcggcgcgctgaccggcaaccaggccgtc
cagcagatccgggcgggtctgaaggccatctacctgtccggctggcaggtcgccgccgac
gccaacctggcgggcgagacctaccccgaccagagcctctacccggccaactcggtccct
gccgtggtccgccgcatcaacaacgcgctgcggcgcgccgaccagatcaactgggccgag
gcgctggacccggaggccgacgagccggagaacatccactggctggccccgatcgtggcc
gacgccgaggccggcttcggcggcacgctcaacgcctacgagctgatgaagggcatgatc
gccgccggtgcggccggtgtgcactgggaggaccagcttgcctccgagaagaagtgcggc
cacctgggcggcaaggtcctcatcccgaccagccagcacgtcaagacgctgaacgcggcc
cggctggccgccgacgtcgcaggcgtgccctcgctggtcgtcgcgcgcaccgacgcgcag
gccgcgacgctgctgaccagcgacgtcgacgagcgcgaccagaagttcatcaccggtgag
cgcacctcggagggcttctacaaggtcaccaacggcatcgagccctgcatcacccgcggt
ctggcctacgcgccgcacgcggacctgatctggatggagacctcgaagccggacctggag
gtcgccaagcagttcgccgaggcgatcaaggcccagtacccggaccagatgctggcctac
aactgctcgccgtcgttcaactggaagaagaacctggacgacagcaccatcgccaagttc
cagcgcgagctcggccacatgggctacaagttccagttcatcaccctggcgggcttccac
tcgctgaactacagcatgttcgacctggccaagggctacgcgcacgacggcatgacctcc
tacgtggacctgcaggagcgcgagttcgccgcggagaaggacggctacaccgcgacccgt
caccagcgcgaggccggtaccggctacttcgacctggtcagcaccgcgatcagcccggac
tcctcgaccaccgccctggcgggttcgaccgagaccgcgcagttctga

DBGET integrated database retrieval system