KEGG   Saccharopolyspora erythraea: SACE_1458Help
Entry
SACE_1458         CDS       T00492                                 

Gene name
echA9
Definition
(GenBank) putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00071  Fatty acid degradation
sen00280  Valine, leucine and isoleucine degradation
sen00281  Geraniol degradation
sen00310  Lysine degradation
sen00360  Phenylalanine metabolism
sen00362  Benzoate degradation
sen00380  Tryptophan metabolism
sen00410  beta-Alanine metabolism
sen00627  Aminobenzoate degradation
sen00640  Propanoate metabolism
sen00650  Butanoate metabolism
sen00903  Limonene and pinene degradation
sen00930  Caprolactam degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01212  Fatty acid metabolism
Module
sen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_1458 (echA9)
   00650 Butanoate metabolism
    SACE_1458 (echA9)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_1458 (echA9)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACE_1458 (echA9)
   00310 Lysine degradation
    SACE_1458 (echA9)
   00360 Phenylalanine metabolism
    SACE_1458 (echA9)
   00380 Tryptophan metabolism
    SACE_1458 (echA9)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_1458 (echA9)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACE_1458 (echA9)
   00281 Geraniol degradation
    SACE_1458 (echA9)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACE_1458 (echA9)
   00627 Aminobenzoate degradation
    SACE_1458 (echA9)
   00930 Caprolactam degradation
    SACE_1458 (echA9)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACE_1458 (echA9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: CAM00780
Cambridge: SACE_1458
Kitasato: SACE_1458
UniProt: A4F9Q5
Position
1608656..1609696
Genome map
AA seq 346 aa AA seqDB search
MTASPEILVSEQGALGRITLNRPKALNALTLGMVRTMSETLCRWRDAEHIEAVLIDGAGE
RGLCAGGDIRALYDAAKAGDEEFPATFWAEEYRLNSALARYPKPVVGLMDGITMGGGVGV
TAHGSHRVVTERSKIGMPEVGIGFVPDVGGTYLLSRAPGELGTHMALTGAPVTGADAVLA
GFADHHVDSSRLGELVEGLAGGAVDQVLGELSQQPPQAPLEAEREWIDAAYSAETVEEIL
RRLRERPEEAARTAAETIQTKSPTSLKVTLRSLRTGFSSLEQALDQEFRVSMACILIGDL
VEGVRATLVDKDRDPKWSPAWLDEVDGALVEKFFEPRGAGELGLDG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttcgcccgagatcctggtcagcgaacagggtgcgctcggacggatcacactc
aaccgcccgaaggcgcttaacgccctgaccctgggcatggtgcgcacgatgagcgagacg
ttgtgccggtggcgcgacgccgagcacatcgaggcggtcctgatcgacggggcgggggag
cgcgggctttgcgcgggcggcgacatccgcgccctctacgacgcggccaaggcgggtgac
gaggagttccccgcgacgttctgggccgaggagtaccggctgaactccgcgctggcgcgc
tacccgaagccggtcgtgggcctgatggacggcatcaccatgggcggtggcgtcggtgtc
accgcgcacggttcgcaccgcgtggtgaccgagcgctccaagatcggcatgccggaggtc
ggcatcggcttcgtgcccgacgtcggcggcacctacctgctgtcccgcgcgccgggtgaa
ctgggcacgcacatggcgctgaccggtgcgcccgtaaccggtgccgacgcggtcctggcg
ggcttcgccgaccaccacgtcgacagctcccggctgggcgagctggtcgaggggctggcc
ggaggcgcggtggaccaggtgctcggggagctctcgcagcagccgccgcaggcgccgctg
gaggccgagcgcgagtggatcgacgcggcgtactccgccgaaaccgtcgaggagatcctg
cggcggctgcgggaacgtccggaggaggcggcgcggaccgcggccgagaccatccagacc
aagtcgccgacgtcgctgaaggtcacactgcggtcgttgcgcaccggcttcagctcgctc
gaacaggccctcgaccaggagttccgggtgtcgatggcctgcatcctgatcggcgacctg
gtcgagggcgtgcgggcgacgctggtggacaaggaccgcgacccgaagtggtcgccggcg
tggctcgacgaggtcgacggcgcgctggtggagaagttcttcgagccgaggggcgccggg
gagctcgggctcgacggctga

DBGET integrated database retrieval system