KEGG   Saccharopolyspora erythraea: SACE_1458Help
Entry
SACE_1458         CDS       T00492                                 

Gene name
echA9
Definition
enoyl-CoA hydratase/isomerase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SACE_1458 (echA9)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_1458 (echA9)
   00650 Butanoate metabolism
    SACE_1458 (echA9)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_1458 (echA9)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACE_1458 (echA9)
   00310 Lysine degradation
    SACE_1458 (echA9)
   00360 Phenylalanine metabolism
    SACE_1458 (echA9)
   00380 Tryptophan metabolism
    SACE_1458 (echA9)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_1458 (echA9)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACE_1458 (echA9)
   00281 Geraniol degradation
    SACE_1458 (echA9)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACE_1458 (echA9)
   00627 Aminobenzoate degradation
    SACE_1458 (echA9)
   00930 Caprolactam degradation
    SACE_1458 (echA9)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACE_1458 (echA9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1608656..1609696
Genome map
AA seq 346 aa AA seqDB search
MTASPEILVSEQGALGRITLNRPKALNALTLGMVRTMSETLCRWRDAEHIEAVLIDGAGE
RGLCAGGDIRALYDAAKAGDEEFPATFWAEEYRLNSALARYPKPVVGLMDGITMGGGVGV
TAHGSHRVVTERSKIGMPEVGIGFVPDVGGTYLLSRAPGELGTHMALTGAPVTGADAVLA
GFADHHVDSSRLGELVEGLAGGAVDQVLGELSQQPPQAPLEAEREWIDAAYSAETVEEIL
RRLRERPEEAARTAAETIQTKSPTSLKVTLRSLRTGFSSLEQALDQEFRVSMACILIGDL
VEGVRATLVDKDRDPKWSPAWLDEVDGALVEKFFEPRGAGELGLDG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttcgcccgagatcctggtcagcgaacagggtgcgctcggacggatcacactc
aaccgcccgaaggcgcttaacgccctgaccctgggcatggtgcgcacgatgagcgagacg
ttgtgccggtggcgcgacgccgagcacatcgaggcggtcctgatcgacggggcgggggag
cgcgggctttgcgcgggcggcgacatccgcgccctctacgacgcggccaaggcgggtgac
gaggagttccccgcgacgttctgggccgaggagtaccggctgaactccgcgctggcgcgc
tacccgaagccggtcgtgggcctgatggacggcatcaccatgggcggtggcgtcggtgtc
accgcgcacggttcgcaccgcgtggtgaccgagcgctccaagatcggcatgccggaggtc
ggcatcggcttcgtgcccgacgtcggcggcacctacctgctgtcccgcgcgccgggtgaa
ctgggcacgcacatggcgctgaccggtgcgcccgtaaccggtgccgacgcggtcctggcg
ggcttcgccgaccaccacgtcgacagctcccggctgggcgagctggtcgaggggctggcc
ggaggcgcggtggaccaggtgctcggggagctctcgcagcagccgccgcaggcgccgctg
gaggccgagcgcgagtggatcgacgcggcgtactccgccgaaaccgtcgaggagatcctg
cggcggctgcgggaacgtccggaggaggcggcgcggaccgcggccgagaccatccagacc
aagtcgccgacgtcgctgaaggtcacactgcggtcgttgcgcaccggcttcagctcgctc
gaacaggccctcgaccaggagttccgggtgtcgatggcctgcatcctgatcggcgacctg
gtcgagggcgtgcgggcgacgctggtggacaaggaccgcgacccgaagtggtcgccggcg
tggctcgacgaggtcgacggcgcgctggtggagaagttcttcgagccgaggggcgccggg
gagctcgggctcgacggctga

DBGET integrated database retrieval system