KEGG   Saccharopolyspora erythraea: SACE_1638Help
Entry
SACE_1638         CDS       T00492                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sen  Saccharopolyspora erythraea
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_1638 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SACE_1638 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SACE_1638 (sucB)
Enzymes [BR:sen01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SACE_1638 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(1805175..1807004)
Genome map
AA seq 609 aa AA seqDB search
MAFSVQMPALGESVTEGTITRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPAAGVLQRIV
AQEDDTIEIGGELAVIGESGESGGGESAPAEQPQQAEPQQPEPQQAEAAQPEPEQQPAPA
QQEAPAQSSGAAQSGSAQGTEVPMPALGESVTEGTITRWLKQVGDTVEVDEPLLEVSTDK
VDTEIPSPVAGTLLEISAGEDDTVEVGAKLAVVGEQGAAPSAPAAPPEEQTAPQQAAPQQ
AAPQQSAPAEQQAPAQQQAPAQPAPQPVQEQPQQAAPAQPAQPSAPAEAPSGAAPYVTPL
VRKLANEHGIDLSKIKGSGVGGRIRKQDVQAAVDAAKAEQEAPAAAPSAPSRPGPAAAQA
VEPSEEAKALRGTTQKMTRLRQLLARRMVESLQTAAQLTTVVEVDVTRIARLRDRAKQNF
EAAEGVKLSFLPFFAKAAAEALKLHPKLNASVDEENKEVTYHAAEHLAIAVDTERGLVSP
VIHDAGDLNLGGLARKIADLAARTRNNKIKPDELSGGTFTLTNTGSRGALFDTPILNPPQ
VGMLGTGTVVKRPVVVTDENGGDTIAIRSMVYLVLSYDHRLVDGADAARFLATLKQRLEE
GAFEADLGL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggcgagagcgtcaccgagggaacgatcacc
aggtggctcaagcaggagggcgacaccgtcgaggtcgacgaacccctgctggaggtctcc
accgacaaggtcgacaccgagatcccctccccggccgccggtgtgctccagcgcatcgtc
gcccaggaggacgacaccatcgagatcggcggcgagctcgccgtgatcggtgagtcgggc
gagtccggcggcggcgagtccgcccccgcggagcagccccagcaggccgagccgcagcag
cccgagccccagcaggccgaggccgcgcagccggagcccgagcagcagcccgccccggcc
cagcaggaggccccggcgcagagctccggtgccgcccagtccggttcggcgcagggcacc
gaggtgccgatgcccgcgctgggcgagagcgtcaccgagggaacgatcaccaggtggctc
aagcaggtcggcgacaccgtcgaggtcgacgaacccctgctggaggtctccaccgacaag
gtcgacaccgagatcccctccccggtggccgggaccctgctggagatctccgccggtgag
gacgacaccgtcgaggtcggcgccaagctggccgtggtcggtgagcagggcgccgcgccg
tcggccccggccgcgccgccggaggagcagaccgccccgcagcaggccgcgccacagcag
gccgcgccacagcagtcggccccggccgagcagcaggcaccggctcagcagcaggctccg
gcccagcccgctccgcagcccgtgcaggagcagccccagcaggccgccccggcgcagccc
gcccagccgtcggctccggccgaggccccctcgggcgccgcgccgtacgtgacgccgctg
gtgcgcaagctggccaacgagcacggcatcgacctgtccaagatcaagggcagcggtgtc
ggcggccggatccgcaagcaggacgtgcaggccgccgtcgacgccgccaaggccgagcag
gaggcgcccgccgcggctccgtcggctccgtcccggcccggcccggcggccgcccaggcc
gtggagccctcggaagaggccaaggcgctgcgcggcaccacccagaagatgacgcggctg
cgccagcttctggcccgccgcatggtcgagtcgctgcagaccgccgcccagctcaccacg
gtggtcgaggtcgacgtcaccagaatcgcccgcctgcgcgaccgcgccaagcagaacttc
gaggcggccgaaggcgtcaagctctccttcctgcccttcttcgccaaggccgcggccgag
gcgctgaagctgcacccgaagctcaacgcttcggtggacgaggagaacaaggaggtcacc
taccacgccgccgagcacctggcgatcgcggtcgacaccgagcgcggcctggtctcgccg
gtgatccacgacgcgggtgacctcaacctcggcgggctggcccgcaagatcgccgacctg
gcggcgcgcacccgcaacaacaagatcaagccggacgagctcagcggcggcacgttcacg
ctgaccaacaccggcagccggggcgcgctgttcgacacgccgatcctgaacccgccgcag
gtgggcatgctgggcaccggcaccgtggtgaagcggccggtcgtggtcaccgacgagaac
ggcggcgacacgatcgccattcgctcgatggtgtacctcgtgctgtcctacgaccaccgc
ctggtcgacggcgcggacgcggcccggttcctggccaccctcaagcagcggctcgaggaa
ggcgccttcgaggccgacctgggcctctga

DBGET integrated database retrieval system