KEGG   Saccharopolyspora erythraea: SACE_1700Help
Entry
SACE_1700         CDS       T00492                                 

Gene name
glk
Definition
RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_1700 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_1700 (glk)
   00052 Galactose metabolism
    SACE_1700 (glk)
   00500 Starch and sucrose metabolism
    SACE_1700 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SACE_1700 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SACE_1700 (glk)
   00524 Butirosin and neomycin biosynthesis
    SACE_1700 (glk)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SACE_1700 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1869149..1870102
Genome map
AA seq 317 aa AA seqDB search
MLTVGVDVGGTSVRASVVDPRGAVLDTLRVPTPDTGEELDSAIADVVRGLALRHPVAAVG
LAVAGFVSEDRRVVRFAPHLAWRHVAVADRIAARVELPVVLEHDANAAAIAEQRFGAAAG
ARVAALVALGTGIGGALVIDGEVFRGAYGVAPELGHLRLVPDGRPCPCGKRGCWERYCSG
TALVSTVRELQERGDGTAGPLLDESTPLTGVRVARAAEEGDPLARRAMRELARWLGEGLA
LVADVYDPEVVVIAGGVSGSAHLFLGEARKHYAKALTGAGHRPLARIAVAKRGDDAGMVG
AATLAREHVVAHQVTGR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaccgttggcgttgacgtcggtggtaccagcgtccgggccagcgtggtcgacccg
cggggcgcggtgctcgacacgctgcgcgtgccgaccccggacaccggcgaggaactggac
tcggcgatcgcggacgtggtgcgcggtctggcgctgaggcacccggtcgcggccgtggga
ctggcggtggccggcttcgtgagcgaggaccgccgcgtcgtgcgcttcgccccgcacctg
gcctggcgccacgtcgccgtcgccgaccggatcgccgcgcgggtcgagctgccggtggtg
ctggagcacgacgccaacgccgcggccatcgccgagcagcgcttcggcgcggcggccggt
gcgcgggtcgccgcgctggtcgcgctcggcaccggcatcggaggggcgctggtgatcgac
ggcgaggtcttccgcggcgcctacggtgtggcgcccgagctgggccacctgcggctggtc
ccggacgggcggccgtgcccgtgcggcaagcgcggctgctgggagcgctactgcagcggt
accgcgctggtcagcacggtgcgggagttgcaggaacggggcgacggcacggccggtccg
ctgctggacgagagcaccccgctgacgggggtgcgggtcgcgcgcgcggccgaggagggc
gacccgctcgcgcgtcgcgcgatgcgggagctggcgcggtggctcggcgagggactggcg
ctggtcgccgacgtctacgacccggaggtcgtggtcatcgcgggcggggtgtccgggtcg
gcgcacctgttcctgggcgaggcgcgcaagcactacgcgaaggcgctcaccggcgcgggg
caccgcccgctggcgcggatcgcggtggccaagcgcggcgacgacgcgggcatggtcggg
gcggcgaccctcgcccgcgagcacgtcgtcgcccaccaggtcaccggccgctga

DBGET integrated database retrieval system