KEGG   Saccharopolyspora erythraea: SACE_1704Help
Entry
SACE_1704         CDS       T00492                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_1704 (pfkA)
   01230 Biosynthesis of amino acids
    SACE_1704 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_1704 (pfkA)
   00030 Pentose phosphate pathway
    SACE_1704 (pfkA)
   00051 Fructose and mannose metabolism
    SACE_1704 (pfkA)
   00052 Galactose metabolism
    SACE_1704 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SACE_1704 (pfkA)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SACE_1704 (pfkA)
Protein phosphatases and associated proteins [BR:sen01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SACE_1704 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
1872725..1873762
Genome map
AA seq 345 aa AA seqDB search
MPTGMRVGVLTGGGDCPGLNAVLRAVTRKGISVYEHEILGFRSGWLGPIEGLTMPLGLDR
VEEILNRGGTILGSSRTNPYKTDDGVTRIKATMQEHGVDALVAIGGEDTLGVADRLTHDG
VPVVGVPKTIDNDLGATDYTFGFDTAVHIATEAIDRLRTTAESHHRALVVEVMGRHAGWI
ALHSGLAGGANVILGPEKRFSVERVCEWVERRFERQYAPIIVVAEGAVPEGGGEVLLTGE
KDAFGHVRLGGVGTWLAEEIAQRTGKESRAVVLGHTQRGGTPTAYDRVLATRFGLHAIDA
VSDGDYGKMVALRGTDIVRVPLSEATAELKTVPLERYTEAEVLFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccgactggaatgcgtgtcggagttctgaccggcggaggtgactgcccggggctgaac
gcggtcctgcgcgcggtgacccgcaaggggatctcggtctacgagcacgagatcctcggg
ttccgcagcggatggctggggccgatcgaagggctgacgatgccgctggggctggaccgg
gtcgaggagatcctgaaccgcggaggcaccatcctcggttcgtcccgcaccaacccctac
aagaccgacgacggcgtcacccggatcaaggccaccatgcaggagcacggggtcgacgcg
ctcgtcgccatcggcggcgaggacaccctcggcgtcgccgaccggctcacccacgacggg
gtgccggtggtcggggtgcccaagaccatcgacaacgacctcggcgccaccgactacacc
ttcgggttcgacaccgccgtgcacatcgccaccgaggcgatcgaccggctgcgcacgacc
gccgagtcccaccaccgcgccctggtggtggaggtgatgggacggcacgcgggctggatc
gcgctgcactcgggcctggcaggcggcgcgaacgtgatcctcgggccggagaagcggttc
agcgtcgagcgggtgtgcgagtgggtcgagcgccggttcgagcggcagtacgcgccgatc
atcgtcgtcgccgagggcgccgtcccggagggcggtggcgaggtgctgctgacgggtgag
aaggacgctttcgggcacgtgcgcctgggcggggtcggcacctggctcgccgaggagatc
gcccagcgcaccggcaaggagtccagggccgtggtcctcgggcacacgcagcgcggcggc
accccgacggcctacgacagggtgctggcgacccgcttcggcctgcacgcgatcgacgcg
gtcagcgacggcgactacggcaagatggtcgcgctgcgcggcaccgacatcgtccgcgtg
ccgctgagcgaggccaccgcggagctcaagaccgtgccgctggagcgctacaccgaggcc
gaggtcctgttcggatga

DBGET integrated database retrieval system