KEGG   Saccharopolyspora erythraea: SACE_1802Help
Entry
SACE_1802         CDS       T00492                                 

Gene name
ppgK
Definition
polyphosphate glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sen01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sen00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sen00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(1985486..1986247)
Genome map
AA seq 253 aa AA seqDB search
MATARGFGVDIGGSGIKGSVVDIDAGVLAEERMRIPTPQPSTPAAVADAVAEIVEKFAWT
GPVGVTLPCVVKRGTAHTAANVDKSWIGTDAQALFAERLGKPREEVVVLNDADAAGLAEM
RSGAGAGHRGLVVLLTFGTGIGSAMFVDGKLIPNTEFGHIEVDGHDAETQAAASVKDNLE
LSYPEWAERVGRYLEGLEKFLWPDLIIAGGGVSRKAHKWLPLLECRTPIVAAELKNDAGI
VGAATAAAGGIEH
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgcccgcggtttcggcgtggacatcggcgggtccggcatcaagggctcggtt
gtggacatcgacgccggtgtgctggccgaggaacgcatgcgcatcccgaccccgcagccc
tcgaccccggccgccgtcgcggacgcggtggccgagatagtcgagaagttcgcgtggacg
ggtccggtcggcgtgacgctgccctgcgtcgtcaagcgcggaacggcccacaccgcagcg
aacgtcgacaagagctggatcggtacagacgcgcaggcgctgttcgccgagcggctcggc
aagccgcgcgaggaggtcgtcgtgctcaacgacgccgacgcggccggcctggccgagatg
cgctccggcgccggcgcgggccaccggggactcgtcgtgctgctgaccttcggcaccggc
atcggcagcgcgatgttcgtcgacggcaaactgatcccgaacaccgagttcggccacatc
gaggtcgacggccacgacgccgagacccaggccgccgcctcggtcaaggacaacctggag
ctgtcctacccggagtgggccgagcgcgtgggcaggtacctggaggggctggagaagttc
ctctggcccgacctgatcatcgcaggtggcggcgtcagccggaaggcgcacaagtggctg
ccgctgctggagtgccgcaccccgatcgtggccgccgagctgaagaacgacgcgggcatc
gtcggcgccgcgacggccgccgcgggcggcatcgagcactga

DBGET integrated database retrieval system