KEGG   Saccharopolyspora erythraea: SACE_1837Help
Entry
SACE_1837         CDS       T00492                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sen00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2019045..2020457
Genome map
AA seq 470 aa AA seqDB search
MPQRVAVVGGGAAGLAAAYELRRELGPQAHITLVEQTDRLGGKLRTVRLAGREFDLGAEA
FLVRRPEVLRLAEELGVDDGIVYPGSASATVRAGGRTRPLPGGTVMGVPSSPEAVQDVLS
EAGVAAVRAEADLPPLELGGADVSVGRLLRERVGDEVVDRLVEPLLGGVYAGNADLLGLR
ATIPALAAAIDAGAQSVTAAAAAALPAPSEPGRKPPVFGAFANGYQRLVDELVRECAAEV
RLGLPVRAVERSGTGWRLEIGSAPTPDVLEADAVVLAVPAPAARRLLSGVVPEAADRMAG
VDVASMVVVGLALPPETPLPDASGVLIARGETHADGTPFTAKAFTFSSRKWPHLRGENGE
LLVRGSVGRFGETEELRLTDEELLRRVRADLSELIGAAVDPVDTAVLRWGGGLPQYGVGH
LDAISGIERAVGEVPGLAVAGAALHGLGVPACVATGQAAAAKVTRDLVAA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcagcgggtcgcggtcgtcggcggcggcgcggccgggctggccgccgcgtacgag
ctgcgccgggagctcgggccgcaggcgcacatcaccctggtcgagcagaccgaccggctc
ggcgggaagctgcgcacggtccggctggcgggccgcgagttcgacctcggagccgaggcg
ttcctggtgcgcaggcccgaagtcctgcggctggccgaggagctgggcgtcgacgacggc
atcgtgtacccgggcagcgcctcggccacggtgcgcgccggcggacggacccggccgctg
cccggcggcaccgtcatgggtgtgccgtcctcgcccgaagccgtccaggacgtcctgtcc
gaagcgggcgtcgcggcggtgcgcgcggaggccgacctgccgccgctggaactgggcgga
gccgacgtgtcggtcggcaggctgctgcgcgaacgggtcggcgacgaggtcgtcgaccgg
ctggtggagccgctgctcggcggggtctacgcgggcaacgccgacctgctcggcctgcgc
gcgacgatccccgcgctcgccgcggccatcgacgccggcgcgcagtcggtcacggccgcg
gcggccgcggcgctgcccgcgccgagcgagccggggcgcaagccgccggtgttcggcgcc
ttcgccaacggctaccagcggctggtcgacgagctcgtccgcgagtgcgccgccgaggtc
cgcctcgggctgccggtgcgggcggtggagcgcagcggaaccggatggcggctggagatc
ggctccgcgccgaccccggacgtgctggaggccgacgcggtcgtgctcgccgtccccgct
cccgcggcccgccggctgctttccggcgtggtgccggaggccgccgaccggatggccggg
gtggacgtcgcctccatggtcgtcgtcggcctggccctgccgcccgagacgccgttgccc
gacgcttcgggcgtgctgatcgcgcgcggcgagacccacgccgacggcacgccgttcacc
gccaaggcgttcaccttctccagccgcaagtggccgcacctgcgcggcgagaacggcgag
ctgctggtccgcggttcggtgggtcgcttcggcgagaccgaggaactgcggctgaccgac
gaggagctgctgcgccgggtgcgcgccgacctctccgagctgatcggcgcggccgtcgac
ccggtcgacaccgccgtgctgcgctggggcggcgggctgccgcagtacggcgtcgggcac
ctcgacgcgatctccggcatcgagcgagccgtcggcgaggtgccggggctggccgtggcg
ggtgccgcgctgcacggcctcggcgtgcccgcctgcgtggcgaccgggcaggcggccgcg
gccaaggtcacgcgagacctcgtggcggcctga

DBGET integrated database retrieval system