KEGG   Saccharopolyspora erythraea: SACE_1940Help
Entry
SACE_1940         CDS       T00492                                 

Gene name
lacZ2
Definition
beta-D-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sen00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sen00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sen00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(2117976..2120342)
Genome map
AA seq 788 aa AA seqDB search
MSSSPFPARFSRRVLHRAAVAAVAVLSLHGPAAGAATGPARRRTPLSRDWLFGPSGEGGA
PDGALSSVDLPHTAAELSWRQWDPASWERRWLYRKHFESTTEPGLRHYLRFAGALTAARP
VLNGHVLPEHAGGYLPFQYEVGDLLRRHNTLDVVVDGSFRPDVPPNHGLDRPSSAVDFWQ
PAGLYREVELVSVPVVHIADVFARPYDVLAGPGLRVRCELDLGRAATGLRVDAELRRDGT
AIGSATTRLPPLPAGRHEVALDMPGLTGVELWSVDAPALHDVVVTLCEQERPVHDHSVRT
GFREARFERSGFYLNGERLQLFGLNRHQFHPFAGGAMPARVQRRDAEILRDELNCNMVRC
SHYPQHEEFLDACDELGLLVWDEPPGWQYLGGPDWLERAYRDVHDMIVRDRNHPSVVLWG
VRLNETPGNAEFYTRTQLLARSLDDSRQTTGAMHGADHGTSDFQHDVFGYNDYSASTARD
GTLRPELAPPRDDLPYLVSEAIGTLSGPSRFYRRTDPQDVQQGQALAHARVHDRGRSDQR
YAGVLAWAGIDYPSGNGNVFLGVKWPGVVDLFRIPKPGAAMYRAQVDPRRRPVIEPSFYW
DLGPPSPVTELGARAAIWSNLERLELYLDGAHHATLAPAREEFPHLPHPPFFADLSTAGD
AVELRVDGALGGRVVLSRRFSADRSRDRLSLRLDGEALRSGGIDATRAELRAVDEHGAPR
AYVSGAVTLELDGPAVLVGSNPFPLADTGGAGAVWLRSTDGTGTVRLRARHPTLGAAEAT
LVVGTGAG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttcccctttcccggcgaggttctcgcggcgcgtcctgcaccgcgccgctgtc
gcggcggtcgcggtgctctcgctgcacggcccggcggcgggggccgcgaccggcccggcg
cggcggcggaccccgctgtcgcgcgactggctgttcggaccgtccggcgagggcggcgca
ccggacggcgcgctgtcctcagtggacctcccgcacaccgctgccgaactctcctggcgg
cagtgggacccggcgtcgtgggagcgccggtggctgtaccgcaagcacttcgagtcgacg
accgagccgggactgcggcactacctgcgcttcgcgggcgcgctgaccgccgcgcggccg
gtgctcaacggccacgtcctgcccgagcacgccggtggctacctcccgttccagtacgag
gtcggcgacctgctgcgcaggcacaacacgctcgacgtggtggtcgacggctccttccgg
cccgacgtgccgccgaaccacggcctggaccgcccgagcagcgccgtggacttctggcag
cccgccggcctctaccgcgaggtcgagctggtcagcgtgccggtggtgcacatcgccgac
gtgttcgccaggccctacgacgtgctcgcgggtcccggactccgggtgcgctgcgagctc
gacctcgggcgggccgccaccggtctgcgcgtggacgccgagctccggcgcgacggcacg
gcgatcggctcggccaccacccggctccctccccttccggcggggaggcacgaggtggcg
ctggacatgccgggcctgaccggggtcgagctctggtccgtcgacgctcccgcgctccac
gacgtggtggtcacgctttgcgagcaggaacggccggtccacgaccactcggtgcgcacg
ggtttccgggaggcccgtttcgagcggtcgggcttctacctcaacggggagcggctgcag
ctgttcggtctcaaccggcaccagttccacccgttcgccggcggcgcgatgcccgcgcgg
gtgcagcgcagggatgccgagatcctgcgcgacgagctgaactgcaacatggtccgctgc
tcgcactacccgcagcacgaggagttcctggacgcctgcgacgagctcgggctgctggtg
tgggacgagccgccgggctggcagtacctgggcggcccggactggctggagcgcgcctac
cgcgacgtgcacgacatgatcgtgcgcgaccgcaaccacccgtcggtggtgctgtggggc
gtccggctcaacgagacgccgggcaacgccgagttctacacccgcacgcaactgctcgcg
aggtcgctcgacgactcccggcagaccacgggcgcgatgcacggagccgaccacggcacg
agcgacttccagcacgacgtgttcggctacaacgactattcggcgagcacggcccgcgac
ggcacgctccgccccgagctggcgccgccgcgcgacgacctgccgtacctggtgagcgag
gcgatcggcacgctgtccggaccttccaggttctaccgccgcaccgacccgcaggacgtg
cagcagggccaggctctcgcgcacgcgcgggtgcacgaccgcggccggtccgaccagcgc
tacgccggagtgctggcgtgggcgggcatcgactacccgtccggcaacggcaacgtcttc
ctgggcgtgaagtggcccggcgtggtcgacctgttccggattcccaagccgggggcggcg
atgtaccgcgcgcaggtcgatccgaggcggcgcccggtgatcgagccgtcgttctactgg
gacctgggaccgccgagcccggtgacggaactcggcgcgcgggcggcgatctggtcgaac
ctcgaacggctcgagctgtacctggacggggcccaccacgcgacgctggcacccgcgcgc
gaggagttcccgcacctgccgcatccgccgttcttcgccgacctgtccaccgcgggtgac
gctgtcgagctgcgggtggacggcgcgctcggcggtcgcgtcgtgctcagccgcaggttc
tccgccgaccgcagccgcgaccggctctcgctgcggctcgacggcgaagccctgcgcagc
ggcggcatcgacgcgacccgcgcagaactgcgggccgtcgacgaacacggcgctccccgc
gcgtacgtttccggcgccgtgaccctggaactcgacggcccggcggtgctggtcggcagc
aacccgtttcccctggcggacacgggcggcgcgggggcggtgtggctgcgcagcaccgac
ggcaccggcaccgtgcggctgcgggcccgccaccccacccttggcgcggccgaagcgacg
ctggtggtggggacgggcgctggttga

DBGET integrated database retrieval system