KEGG   Saccharopolyspora erythraea: SACE_1940Help
Entry
SACE_1940         CDS       T00492                                 

Gene name
lacZ2
Definition
(GenBank) beta-D-galactosidase protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00052  Galactose metabolism
sen00511  Other glycan degradation
sen00600  Sphingolipid metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SACE_1940 (lacZ2)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SACE_1940 (lacZ2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SACE_1940 (lacZ2)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SACE_1940 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: CAM01251
Cambridge: SACE_1940
Kitasato: SACE_1940
UniProt: A4FB26
Position
complement(2117976..2120342)
Genome map
AA seq 788 aa AA seqDB search
MSSSPFPARFSRRVLHRAAVAAVAVLSLHGPAAGAATGPARRRTPLSRDWLFGPSGEGGA
PDGALSSVDLPHTAAELSWRQWDPASWERRWLYRKHFESTTEPGLRHYLRFAGALTAARP
VLNGHVLPEHAGGYLPFQYEVGDLLRRHNTLDVVVDGSFRPDVPPNHGLDRPSSAVDFWQ
PAGLYREVELVSVPVVHIADVFARPYDVLAGPGLRVRCELDLGRAATGLRVDAELRRDGT
AIGSATTRLPPLPAGRHEVALDMPGLTGVELWSVDAPALHDVVVTLCEQERPVHDHSVRT
GFREARFERSGFYLNGERLQLFGLNRHQFHPFAGGAMPARVQRRDAEILRDELNCNMVRC
SHYPQHEEFLDACDELGLLVWDEPPGWQYLGGPDWLERAYRDVHDMIVRDRNHPSVVLWG
VRLNETPGNAEFYTRTQLLARSLDDSRQTTGAMHGADHGTSDFQHDVFGYNDYSASTARD
GTLRPELAPPRDDLPYLVSEAIGTLSGPSRFYRRTDPQDVQQGQALAHARVHDRGRSDQR
YAGVLAWAGIDYPSGNGNVFLGVKWPGVVDLFRIPKPGAAMYRAQVDPRRRPVIEPSFYW
DLGPPSPVTELGARAAIWSNLERLELYLDGAHHATLAPAREEFPHLPHPPFFADLSTAGD
AVELRVDGALGGRVVLSRRFSADRSRDRLSLRLDGEALRSGGIDATRAELRAVDEHGAPR
AYVSGAVTLELDGPAVLVGSNPFPLADTGGAGAVWLRSTDGTGTVRLRARHPTLGAAEAT
LVVGTGAG
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttcccctttcccggcgaggttctcgcggcgcgtcctgcaccgcgccgctgtc
gcggcggtcgcggtgctctcgctgcacggcccggcggcgggggccgcgaccggcccggcg
cggcggcggaccccgctgtcgcgcgactggctgttcggaccgtccggcgagggcggcgca
ccggacggcgcgctgtcctcagtggacctcccgcacaccgctgccgaactctcctggcgg
cagtgggacccggcgtcgtgggagcgccggtggctgtaccgcaagcacttcgagtcgacg
accgagccgggactgcggcactacctgcgcttcgcgggcgcgctgaccgccgcgcggccg
gtgctcaacggccacgtcctgcccgagcacgccggtggctacctcccgttccagtacgag
gtcggcgacctgctgcgcaggcacaacacgctcgacgtggtggtcgacggctccttccgg
cccgacgtgccgccgaaccacggcctggaccgcccgagcagcgccgtggacttctggcag
cccgccggcctctaccgcgaggtcgagctggtcagcgtgccggtggtgcacatcgccgac
gtgttcgccaggccctacgacgtgctcgcgggtcccggactccgggtgcgctgcgagctc
gacctcgggcgggccgccaccggtctgcgcgtggacgccgagctccggcgcgacggcacg
gcgatcggctcggccaccacccggctccctccccttccggcggggaggcacgaggtggcg
ctggacatgccgggcctgaccggggtcgagctctggtccgtcgacgctcccgcgctccac
gacgtggtggtcacgctttgcgagcaggaacggccggtccacgaccactcggtgcgcacg
ggtttccgggaggcccgtttcgagcggtcgggcttctacctcaacggggagcggctgcag
ctgttcggtctcaaccggcaccagttccacccgttcgccggcggcgcgatgcccgcgcgg
gtgcagcgcagggatgccgagatcctgcgcgacgagctgaactgcaacatggtccgctgc
tcgcactacccgcagcacgaggagttcctggacgcctgcgacgagctcgggctgctggtg
tgggacgagccgccgggctggcagtacctgggcggcccggactggctggagcgcgcctac
cgcgacgtgcacgacatgatcgtgcgcgaccgcaaccacccgtcggtggtgctgtggggc
gtccggctcaacgagacgccgggcaacgccgagttctacacccgcacgcaactgctcgcg
aggtcgctcgacgactcccggcagaccacgggcgcgatgcacggagccgaccacggcacg
agcgacttccagcacgacgtgttcggctacaacgactattcggcgagcacggcccgcgac
ggcacgctccgccccgagctggcgccgccgcgcgacgacctgccgtacctggtgagcgag
gcgatcggcacgctgtccggaccttccaggttctaccgccgcaccgacccgcaggacgtg
cagcagggccaggctctcgcgcacgcgcgggtgcacgaccgcggccggtccgaccagcgc
tacgccggagtgctggcgtgggcgggcatcgactacccgtccggcaacggcaacgtcttc
ctgggcgtgaagtggcccggcgtggtcgacctgttccggattcccaagccgggggcggcg
atgtaccgcgcgcaggtcgatccgaggcggcgcccggtgatcgagccgtcgttctactgg
gacctgggaccgccgagcccggtgacggaactcggcgcgcgggcggcgatctggtcgaac
ctcgaacggctcgagctgtacctggacggggcccaccacgcgacgctggcacccgcgcgc
gaggagttcccgcacctgccgcatccgccgttcttcgccgacctgtccaccgcgggtgac
gctgtcgagctgcgggtggacggcgcgctcggcggtcgcgtcgtgctcagccgcaggttc
tccgccgaccgcagccgcgaccggctctcgctgcggctcgacggcgaagccctgcgcagc
ggcggcatcgacgcgacccgcgcagaactgcgggccgtcgacgaacacggcgctccccgc
gcgtacgtttccggcgccgtgaccctggaactcgacggcccggcggtgctggtcggcagc
aacccgtttcccctggcggacacgggcggcgcgggggcggtgtggctgcgcagcaccgac
ggcaccggcaccgtgcggctgcgggcccgccaccccacccttggcgcggccgaagcgacg
ctggtggtggggacgggcgctggttga

DBGET integrated database retrieval system