KEGG   Saccharopolyspora erythraea: SACE_2022Help
Entry
SACE_2022         CDS       T00492                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sen  Saccharopolyspora erythraea
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sen00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SACE_2022 (ruvA)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SACE_2022 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2207305..2207907
Genome map
AA seq 200 aa AA seqDB search
MIASVRGPVLSVGLDHAVIEVGGVGMAVHATPATLAGLRRGEEARLWTSLIVREDSLTLY
GFADAEARDLFGLLQTASGVGPRLALATLAVLAPDQLCHALSDGNITTLTQVPGVGKKSA
ERLILELRDKVGTVAGTAGAGAQAPDRGRVRSEVSEALVGLGFSAKQAEQSVEAVLAADG
PVSDTSAVLRKALAALGPKK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtgcggggcccggtgctgtcggtcgggctcgaccacgccgtgatcgag
gtcggcggtgtcggcatggccgtgcacgccacgccggccaccctggccggtctgcggcgc
ggggaggaggcgcggctttggacctcgctgatcgtgcgcgaggactccctgacgctgtac
ggcttcgccgacgccgaggcccgcgacctgttcggactgctgcagaccgcctccggggtc
ggcccgcggctggcgctggcgacgctggcggtgctcgcccccgaccagctctgccacgcg
ctctccgacggcaacatcaccacgctcacccaggtccccggcgtgggcaagaagagcgcc
gagcggctgatcctggagctgcgcgacaaggtcggtacggtggccgggaccgcgggcgcc
ggggcgcaggcacccgaccggggccgggtgcgctcggaggtgtccgaggcgctggtcggc
ctgggcttctcggcgaagcaggccgagcagagcgtcgaggcggtgctcgccgccgacggc
ccggtctccgacacctcggcggtgctgcgcaaggcgctggcggcgctcggcccgaagaag
tga

DBGET integrated database retrieval system