KEGG   Saccharopolyspora erythraea: SACE_2079Help
Entry
SACE_2079         CDS       T00492                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic chain
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00240  Pyrimidine metabolism
sen00250  Alanine, aspartate and glutamate metabolism
sen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SACE_2079 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SACE_2079 (pyrB)
Enzymes [BR:sen01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SACE_2079 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace DUF4431 LytR_C
Motif
Other DBs
NCBI-ProteinID: CAM01386
Cambridge: SACE_2079
Kitasato: SACE_2079
UniProt: A4FBG1
Position
2264658..2265590
Genome map
AA seq 310 aa AA seqDB search
MRHLLSTEGLDAATATAVLDTAGTLKQTLLGREVRKLPTLRGRTVVTMFYENSTRTRVSF
EVAGKWMSADVINVSAGASSVGKGESLRDTALTLSAAGADCVIVRHPASGAAHRLAGWLE
ATGTQVVNAGDGMHEHPTQALLDAATLRERLGELAGRRVAIVGDLLHSRVARSNVHLLRT
LGAQVVLVAPPTLVPAGVEHWGAEVRHELDPELPGLDAVMLLRVQAERMHGGFFPSAREY
SIAYGMNEARLARLPEHAVVLHPGPMLRGMEIAPAVADSPRAAITEQVRNGVHVRMAVLY
HLLAGEEIAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacctgctgtccaccgaggggctcgacgcggccaccgcgaccgccgtgctcgac
accgcgggcaccctcaagcagaccctgctcggccgggaggtccgcaagctgccgacgctg
cgcgggcggaccgtggtgacgatgttctacgagaactccacccggacccgggtgtccttc
gaggtcgcgggcaagtggatgagcgccgacgtgatcaacgtgtcggccggcgcctcgtcg
gtcggcaagggcgagtcgctgcgcgacaccgcgctgaccctgtcggcggcgggtgcggac
tgcgtgatcgtgcgccacccggcctccggcgcggcgcaccggctggcgggctggctggag
gccaccggcacccaggtcgtcaacgccggtgacggcatgcacgagcacccgacgcaggcg
ctgctggacgccgcgacgctgcgcgagcggctgggcgagctggcgggcaggcgcgtcgcg
atcgtcggcgacctgctgcacagccgggtcgcgcgctccaacgtgcacctgctgcgcacg
ctcggcgcgcaggtcgtgctggtcgcgccgccgacgctggtacccgccggcgtcgagcac
tggggcgccgaggtccgccacgagctcgatccggaactgcccgggctcgacgcggtgatg
ctgctgcgggtgcaggccgagcggatgcacggcgggttcttcccgtcggcgcgcgagtac
tcgatcgcctacggcatgaacgaggccaggctcgccaggctgcccgagcacgccgtggtg
ctgcaccccggtccgatgctgcgcggcatggagatcgccccggcggtggccgactccccg
cgggcggccatcaccgagcaggtccgcaacggcgtgcacgtgcggatggcggtgctctac
cacctgttggccggagaggagatcgcggcatga

DBGET integrated database retrieval system