KEGG   Saccharopolyspora erythraea: SACE_2079Help
Entry
SACE_2079         CDS       T00492                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sen  Saccharopolyspora erythraea
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sen00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sen00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2264658..2265590
Genome map
AA seq 310 aa AA seqDB search
MRHLLSTEGLDAATATAVLDTAGTLKQTLLGREVRKLPTLRGRTVVTMFYENSTRTRVSF
EVAGKWMSADVINVSAGASSVGKGESLRDTALTLSAAGADCVIVRHPASGAAHRLAGWLE
ATGTQVVNAGDGMHEHPTQALLDAATLRERLGELAGRRVAIVGDLLHSRVARSNVHLLRT
LGAQVVLVAPPTLVPAGVEHWGAEVRHELDPELPGLDAVMLLRVQAERMHGGFFPSAREY
SIAYGMNEARLARLPEHAVVLHPGPMLRGMEIAPAVADSPRAAITEQVRNGVHVRMAVLY
HLLAGEEIAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacctgctgtccaccgaggggctcgacgcggccaccgcgaccgccgtgctcgac
accgcgggcaccctcaagcagaccctgctcggccgggaggtccgcaagctgccgacgctg
cgcgggcggaccgtggtgacgatgttctacgagaactccacccggacccgggtgtccttc
gaggtcgcgggcaagtggatgagcgccgacgtgatcaacgtgtcggccggcgcctcgtcg
gtcggcaagggcgagtcgctgcgcgacaccgcgctgaccctgtcggcggcgggtgcggac
tgcgtgatcgtgcgccacccggcctccggcgcggcgcaccggctggcgggctggctggag
gccaccggcacccaggtcgtcaacgccggtgacggcatgcacgagcacccgacgcaggcg
ctgctggacgccgcgacgctgcgcgagcggctgggcgagctggcgggcaggcgcgtcgcg
atcgtcggcgacctgctgcacagccgggtcgcgcgctccaacgtgcacctgctgcgcacg
ctcggcgcgcaggtcgtgctggtcgcgccgccgacgctggtacccgccggcgtcgagcac
tggggcgccgaggtccgccacgagctcgatccggaactgcccgggctcgacgcggtgatg
ctgctgcgggtgcaggccgagcggatgcacggcgggttcttcccgtcggcgcgcgagtac
tcgatcgcctacggcatgaacgaggccaggctcgccaggctgcccgagcacgccgtggtg
ctgcaccccggtccgatgctgcgcggcatggagatcgccccggcggtggccgactccccg
cgggcggccatcaccgagcaggtccgcaacggcgtgcacgtgcggatggcggtgctctac
cacctgttggccggagaggagatcgcggcatga

DBGET integrated database retrieval system