KEGG   Saccharopolyspora erythraea: SACE_2145Help
Entry
SACE_2145         CDS       T00492                                 

Gene name
tpiA,tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:sen01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sen01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sen00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sen00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sen00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2330398..2331183
Genome map
AA seq 261 aa AA seqDB search
MARQPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYFAKVEVAVIPPFTDIRSVQTLIDGD
KLLLKHGAQDVSEHESGAYTGEVSGPMLAKLGCSYVVVGHSERREHHAETDEVVNRKVRA
VLKHGMSPILCVGEPLEVREAGGHVEHSTTQLINALKGLKTEQIRQVVVAYEPVWAIGTG
KVATAADAQEVCAALRTALADKYGKEIADEVRVLYGGSVKSSNIGELIGQNDVDGALVGG
ASLNGDEFTKLSAMAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcaaccgctgatcgcgggcaactggaagatgaacctcaaccacctcgaggcc
atcgccctggtgcagaagatcgccttctccctgccggagaagtacttcgccaaggtcgag
gtggcggtgatcccgccgttcaccgacatccgcagcgtgcagacgctgatcgacggcgac
aagctcctgctcaagcacggcgcgcaggacgtctccgagcacgagtccggtgcctacacc
ggtgaggtgtccggcccgatgctggccaagctcggctgcagctacgtcgtcgtcggccac
tccgaacgccgcgagcaccacgccgagaccgacgaggtcgtcaaccgcaaggtgcgcgcg
gtgctcaagcacgggatgtcgccgatcctctgcgtcggcgagccgctggaggtgcgcgag
gccggcgggcacgtcgagcacagcaccacccagctcatcaacgcgctcaaggggctgaaa
accgagcagattcgccaggtcgtggtggcttacgagccggtgtgggcgatcgggaccggt
aaggtcgcgaccgcggcggacgcgcaggaggtgtgcgcggcgctgcggaccgccctggcg
gacaagtacggcaaggagatcgccgacgaggtccgggtcctctacgggggctcggtgaag
tccagcaacatcggcgagctcatcggccagaacgacgtcgacggcgctctggtcggcggg
gccagcctcaacggcgacgagttcaccaagctcagcgccatggccgcgggcggacccctg
ccgtga

DBGET integrated database retrieval system