KEGG   Saccharopolyspora erythraea: SACE_2145Help
Entry
SACE_2145         CDS       T00492                                 

Gene name
tpiA,tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_2145 (tpiA)
   01230 Biosynthesis of amino acids
    SACE_2145 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2145 (tpiA)
   00051 Fructose and mannose metabolism
    SACE_2145 (tpiA)
   00562 Inositol phosphate metabolism
    SACE_2145 (tpiA)
Enzymes [BR:sen01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SACE_2145 (tpiA)
Exosome [BR:sen04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SACE_2145 (tpiA)
  Exosomal proteins of bladder cancer cells
   SACE_2145 (tpiA)
  Exosomal proteins of melanoma cells
   SACE_2145 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2330398..2331183
Genome map
AA seq 261 aa AA seqDB search
MARQPLIAGNWKMNLNHLEAIALVQKIAFSLPEKYFAKVEVAVIPPFTDIRSVQTLIDGD
KLLLKHGAQDVSEHESGAYTGEVSGPMLAKLGCSYVVVGHSERREHHAETDEVVNRKVRA
VLKHGMSPILCVGEPLEVREAGGHVEHSTTQLINALKGLKTEQIRQVVVAYEPVWAIGTG
KVATAADAQEVCAALRTALADKYGKEIADEVRVLYGGSVKSSNIGELIGQNDVDGALVGG
ASLNGDEFTKLSAMAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcaaccgctgatcgcgggcaactggaagatgaacctcaaccacctcgaggcc
atcgccctggtgcagaagatcgccttctccctgccggagaagtacttcgccaaggtcgag
gtggcggtgatcccgccgttcaccgacatccgcagcgtgcagacgctgatcgacggcgac
aagctcctgctcaagcacggcgcgcaggacgtctccgagcacgagtccggtgcctacacc
ggtgaggtgtccggcccgatgctggccaagctcggctgcagctacgtcgtcgtcggccac
tccgaacgccgcgagcaccacgccgagaccgacgaggtcgtcaaccgcaaggtgcgcgcg
gtgctcaagcacgggatgtcgccgatcctctgcgtcggcgagccgctggaggtgcgcgag
gccggcgggcacgtcgagcacagcaccacccagctcatcaacgcgctcaaggggctgaaa
accgagcagattcgccaggtcgtggtggcttacgagccggtgtgggcgatcgggaccggt
aaggtcgcgaccgcggcggacgcgcaggaggtgtgcgcggcgctgcggaccgccctggcg
gacaagtacggcaaggagatcgccgacgaggtccgggtcctctacgggggctcggtgaag
tccagcaacatcggcgagctcatcggccagaacgacgtcgacggcgctctggtcggcggg
gccagcctcaacggcgacgagttcaccaagctcagcgccatggccgcgggcggacccctg
ccgtga

DBGET integrated database retrieval system