KEGG   Saccharopolyspora erythraea: SACE_2215Help
Entry
SACE_2215         CDS       T00492                                 

Definition
magnesium chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACE_2215
Enzymes [BR:sen01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SACE_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2405712..2407118
Genome map
AA seq 468 aa AA seqDB search
MTSIPTPPPGLPRTAGELRSSGHLPRSVKAEVRGNLLTALRSGRTVWPGIVGFDQTVLPQ
LERALIAGHDVVLLGERGQGKTRLLRGLTELLDEWAPVIEGSELDEHPLEPITPVSLRRA
AEEGDDLPVAWRHRSERYSEKLATPDTAVGDLIGDVDPVKVAEGRSLGDPETIHFGLVPR
AHRGIVTINELPDLAERIQVALLNVMEERDIQIRGYSLRLPLDVLLVATANPEDYTNRGR
IITPLKDRFGAEIRTHYPLDLEDEISLVRQEAVLEAEVGDHLLEVLARFVGHLRESPAVD
QRSGVSARFAIAAAETVSAAAVHRSALIGEEPAVARPVDLDAVPAVLRGKIEFEAGEEGR
EDELLGYLLRRSVADTARSAFAGLDLQSLADTVVDGHQVATGERIAARDVLTALPELPVL
HQVAERLDVRAGDPPGRIASAVELALESLYLSKRLSKDVEDDRSVYGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcatcccgaccccacccccgggcctcccgcgaaccgcgggggagctgcgctcc
agcggccacctcccgcgcagcgtcaaggcggaggtgcgcggcaacctgctgaccgcgctg
cgctcggggcgcacggtctggcccggaatcgtcgggttcgaccagaccgtgctgccgcag
ctggaacgcgccctgatcgccggccacgacgtggtgctgctcggcgagcgcgggcagggc
aagacccggctgctgcgcggcctcaccgagctgctcgacgaatgggccccggtgatcgag
ggctccgagctggacgagcacccgctggagccgatcacgccggtgtcgctgcggcgcgcg
gccgaggagggcgacgacctgccggtggcgtggcgccaccgcagcgagcgctactccgag
aagctggccacaccggacaccgcggtcggcgacctcatcggtgacgtcgacccggtcaag
gtcgccgaaggccggtcgctgggcgacccggagaccatccacttcggactcgttccccgc
gcgcaccgcggcatcgtcaccatcaacgagctgcccgacctggccgagcgcatccaggtc
gcgctgctgaacgtgatggaggagcgcgacatccagatccgcggctacagcctgcggttg
ccgctggacgtgctgctcgtggccaccgcaaaccccgaggactacaccaaccgcggacgc
atcatcacaccgctgaaggaccgcttcggcgccgagatccgcacccactacccgctggac
ctggaagacgagatctcgctggtccgccaggaggcggtgctcgaggccgaggtcggcgac
cacctgctggaggtgctggcgcgcttcgtcggtcacctgcgggagtccccggcggtcgac
cagcgatccggcgtctcggcccgcttcgccatcgccgccgccgagaccgtctccgccgca
gccgtgcaccgcagcgcgctcatcggtgaggagcccgcggtggcgcggccggtggacctc
gacgccgtgcccgcggtgctgcgcggcaagatcgagttcgaggccggcgaggagggccgg
gaggacgaactgctcggctacctgctgcgccgctcggtggccgacaccgcgcgctccgcg
ttcgccgggctcgacctgcagtcgctggccgacaccgtcgtcgacggccaccaggtcgcc
accggggagcggatcgcggcccgcgacgtgctcaccgcgctgccggagctgccggtcctg
caccaggtcgccgagcgcctggacgtgcgcgccggcgacccgccgggccgcatcgccagc
gccgtcgagctcgcgctggagtcgctgtacctgtccaagcggctgagcaaggacgtcgag
gacgacaggtcggtgtacgggcgatga

DBGET integrated database retrieval system