KEGG   Saccharopolyspora erythraea: SACE_2289Help
Entry
SACE_2289         CDS       T00492                                 

Definition
dolichyl-phosphate beta-D-mannosyltransferase (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
sen  Saccharopolyspora erythraea
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2478929..2479717
Genome map
AA seq 262 aa AA seqDB search
MAKRQDPLDGPAGSPGSAVVVIPTYNERDNLGPIVDRLLTALPQVHVLVVDDGSPDGTGE
VADRLAAADERVHVMHRTQKAGLGAAYVAGFEWALQRDYEAVIEMDADGSHSPEELPRLF
AVLAAGADVVIGSRYVPGGRVVNWPWHREALSRGANLYSKLALGLSINDITAGYRVYRRE
VLEKLDLRGVESAGYCFQVDLTWRAVKAGCTVVEAPITFIEREVGESKMSGSVVREALLR
VTEWGVRRRGGQALDLLRRTLR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcggcaagaccccctcgacggcccggcggggagtccaggctcggcggtggtg
gtgatccccacctacaacgagcgggacaacctgggccccatcgtggaccggttgctgacc
gcgctgccgcaggtgcacgtgctggtcgtcgacgacggcagcccggacgggacgggcgag
gtcgccgaccggctcgccgcggccgacgaacgggtgcacgtgatgcaccggactcagaag
gcgggtcttggcgccgcctacgtcgcaggtttcgagtgggcgctgcagcgtgactacgag
gccgtcatcgagatggacgccgacggttcgcactccccggaggagctgccccggctgttc
gcggtgctggccgccggcgccgacgtggtgatcggttcccgctacgtgccgggtgggcgc
gtggtcaactggccctggcaccgcgaggcgctgtcgcggggcgcgaacctctactccaag
ctcgccctggggctctcgatcaacgacatcaccgccggctaccgcgtgtaccgccgcgag
gtactggagaagctcgaccttcgcggcgtggagtcggcgggctattgcttccaggtggac
ctgacctggcgcgcggtgaaggcgggctgcacggtggtggaggccccgatcaccttcatc
gagcgcgaggtcggcgagtcgaagatgagcggctcggtcgtgcgcgaggcgttgctgcgc
gtgaccgagtggggagttcgccgacggggcggtcaggctctggacctgctgcggcggacc
ctgcgctga

DBGET integrated database retrieval system