KEGG   Saccharopolyspora erythraea: SACE_2374Help
Entry
SACE_2374         CDS       T00492                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SACE_2374
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2374
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_2374
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_2374
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_2374
   00626 Naphthalene degradation
    SACE_2374
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_2374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(2574996..2576009)
Genome map
AA seq 337 aa AA seqDB search
MKAAVVHDFAKELTLTEVPKPEPGPGEVVVKIETSGLCHTDIHAAHGDWPVKPKLPLIPG
HEGVGIVESVGAEVTEVAEGDRVAIPWLGVACGTCDYCTSGWETLCEKQLNTGYLIDGGY
AEYAKASAKYVAKVPDGVDPLDAAPLTCAGVTTYKAVKLSGARPAATVAVFGIGGLGHLA
LQYAKIFGARVIAVDVVDEKLELARELGADHTVNALTEDPVQAIKDLGGADAAISVAVAP
KAFEQAYSSLRRGGKLVFVALPADNQVQLPIFETVLNGITIIGSIVGTRGDLDEVFRLHQ
QGRTRVIRESRRLEEVNTCFEEVEKGQVKARLVFDLR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtcgtccacgacttcgccaaggaactgacactgaccgaggtccccaag
cccgagccgggtccgggcgaagtcgtcgtgaagatcgaaacatccggcctgtgccacacc
gatatccacgcggcgcacggtgattggccggtcaagcccaaactcccgctcatccccggc
cacgagggcgtgggcatcgtcgagagcgtcggcgcggaggtgaccgaagtagccgaaggc
gaccgggtggccatcccgtggctcggcgtcgcttgcggcacctgcgactactgcaccagc
ggttgggaaacgctgtgcgagaagcagctcaacaccggctatctcatcgacggcggctac
gccgagtacgccaaggcatcggcgaagtacgtcgccaaggtcccggacggcgtggacccg
ctggacgccgcaccgctcacctgcgcgggcgtgacgacctacaaggcggtgaagctttcc
ggcgcccgcccggccgccaccgtcgccgtgttcggcatcggcggactcggacatctcgcc
ctccagtacgccaagatcttcggcgcgagggtcatcgcggtcgacgtggtggacgaaaag
ctcgaactcgcccgggaactcggggctgaccacaccgtcaacgccctcaccgaggacccc
gtgcaggcgatcaaggacctcggcggcgccgacgccgcgatctcggtcgcggtggcgccg
aaggcgttcgaacaggcctacagctcgctgcgccgaggcggcaaactcgtgttcgtcgcg
ctgcccgcggacaaccaggtgcaactgccgatcttcgagacggttctcaacggcatcacc
atcatcggctccatcgtgggcacgcggggcgacctggacgaggtcttccgactgcaccag
caaggtcgtaccagggtgatccgggaaagtcgtcgcctcgaagaggtcaacacctgcttc
gaggaagtcgagaagggacaggtcaaagcccggctcgtgttcgacctgcgctga

DBGET integrated database retrieval system