KEGG   Saccharopolyspora erythraea: SACE_2420Help
Entry
SACE_2420         CDS       T00492                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_2420
   01230 Biosynthesis of amino acids
    SACE_2420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2420
   00030 Pentose phosphate pathway
    SACE_2420
   00051 Fructose and mannose metabolism
    SACE_2420
  Energy metabolism
   00680 Methane metabolism
    SACE_2420
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SACE_2420
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SACE_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
2623935..2625053
Genome map
AA seq 372 aa AA seqDB search
MVTLSIIKADTGGFVGHSAVHPEMVTEARDAVSTAVGDGLLLDGKVASCGDDLSLIMTHE
RGADAEEVHSFAWDVFGRTTGIAKRLGLYGAGQDLLSDAFSGNLRGMGPGYAELEFTERP
SEPVVCFLADKTEPGAWNLPLYKIFADPFNTAGLVIDAKMHAGFRFEVYDLFEEKRIWFD
CPSELYEMLMFIGAPARYVIHSVESKTLDEQAVATSTQRLSLIAGKYVGKDDPVMIVRCQ
SGLPALGEVLEPFAFAYTAGGCMRGSHHAPMMPVSTGDAHPARFDGPPRVVALGFQVHES
KLIGPRDLFDDPSFDRARAQCNEVMDYLRRHGPFEPHRLPLEDLEYTTMATLEKRLADRW
QPMVEAAVPVPR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgctgagcatcatcaaggccgacaccgggggattcgtgggtcactcggccgtg
catccggagatggtgaccgaggcccgggacgcggtgagcaccgcggtcggcgacgggttg
ttgttggatgggaaggtcgccagttgcggagacgacctctcgttgatcatgacgcacgag
cgcggtgcggacgccgaggaggtgcactcgttcgcgtgggacgtgttcggccggaccacg
gggatcgcgaagcggctcggcctgtacggggccgggcaggatctgctgtcggacgccttc
agcgggaacctgcgtggcatggggccggggtatgccgagctggagttcaccgagcggccg
agcgaaccggtggtgtgcttcctggccgacaagaccgagccgggcgcgtggaacctgccg
ctgtacaagattttcgccgatccgttcaacaccgccgggttggtgatcgacgcgaagatg
cacgccgggttcaggttcgaggtctacgacctgttcgaggagaagcggatctggttcgac
tgcccgtccgagttgtacgagatgctgatgttcatcggcgctccggcgcggtacgtgatc
cactcggtggagtccaagacgctggacgagcaggcggtggcgacctccacgcagcggttg
tcgctgatcgcgggcaagtacgtcggcaaggacgatccggtgatgatcgtgcgttgccag
tccggtctgcctgcgctgggtgaggtgctggagccgttcgccttcgcctacacggcaggc
gggtgcatgcggggttcgcaccacgcgccgatgatgcccgtcagcaccggcgacgcgcac
ccggcgaggttcgacgggccgccgcgtgtggtcgccctgggcttccaggtccacgagagc
aagctcatcggaccgcgtgatctgttcgacgatccgtcgttcgaccgggccagggcgcag
tgcaacgaggtgatggactacctgaggcgacacgggccgttcgagccgcaccggcttccg
ctggaggacctggagtacacgaccatggcgactctggagaagcgcctggcagaccgctgg
cagccgatggtcgaagcagccgtgccagtgccgcgctga

DBGET integrated database retrieval system