KEGG   Saccharopolyspora erythraea: SACE_2738Help
Entry
SACE_2738         CDS       T00492                                 

Definition
(GenBank) alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00071  Fatty acid degradation
sen00350  Tyrosine metabolism
sen00625  Chloroalkane and chloroalkene degradation
sen00626  Naphthalene degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2738
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_2738
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_2738
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_2738
   00626 Naphthalene degradation
    SACE_2738
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C Methyltransf_25 AlaDh_PNT_C TrkA_N Glu_dehyd_C 3HCDH_N MTS
Motif
Other DBs
NCBI-ProteinID: CAM02019
Cambridge: SACE_2738
Kitasato: SACE_2738
UniProt: A4FD94
Position
complement(2995463..2996500)
Genome map
AA seq 345 aa AA seqDB search
MTAVRLPDWGRSPVVTELARPLPRDGQVLVRVEAVGLCRSDLHVIDADRGTMPFRPPFTL
GHEVAGRITAHGPAAAVTVGRRVVIHGPWGCGSCLRCTQGRDNYCDRRAELSWAGMGLGL
DGGMAEYVLVPSARHLVPIGDLDAGEAAPLTDAGLTSYHAVAGIRPRLGADSTVAVIGVG
GLGHLAVQMLRALTPCRVIAVDVREEALALAERSGAHLSTKATTDTSRVLRATTSGTGVD
AVLDFVGSRSTLDLGTRGLRADGDLVLVGSGGGELTVRKPGSLPPGSRISLPFWGSRDEL
ADVVALSRSGALKVEAERFPLTAVHEAMSALRDGRLSGRAVLVPG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggtgcgcctgccggactggggacgttcgccggtcgtcaccgagctcgcgcgg
ccgctcccccgcgacggccaggtcctcgtgcgcgtcgaagccgtcggcctgtgccgctcg
gacctgcacgtcatcgacgcggaccgcgggaccatgccgttccgcccgccgttcacgctc
ggacacgaggtcgccgggcggatcaccgcgcacgggcccgcagcggcggtgaccgtcggc
cgacgagtcgtcatccatggcccctggggatgcgggagttgcctgcggtgcacgcaagga
cgcgacaactactgcgaccgcagagccgagctgtcctgggccgggatgggactgggcctt
gatggcgggatggccgagtacgtcctcgtcccgtccgccaggcacctggtcccgatcggg
gacctggacgccggcgaggccgctccgctgaccgacgcgggcctgacctcctaccacgcg
gtggcgggcatccgcccccggctcggtgcggactcgaccgtcgcggtcatcggggtcggc
ggtctcggacacctggcggtccagatgctccgcgcactgactccctgccgggtgatcgcc
gtggacgtgcgcgaggaagccctcgccctcgccgagcgctcgggagcgcacctcagcacc
aaggcgacgaccgacacgagccgcgtcctgcgggccacgaccagcggcaccggcgtcgac
gccgtcctcgacttcgtcggcagccgctcgacgctcgacctgggtacccgcgggctgcgc
gcagacggggacctggtgctggtcggcagcggcggtggagaactcaccgtgcgcaagccc
ggttcgctgccgccgggaagccggatctcgctgccgttctggggcagccgggacgaactc
gccgacgtcgtcgccctcagccgttctggggcgctcaaggtggaagccgagcggttcccc
ctcacggcggtccatgaggcgatgtccgcgctgcgcgacgggagactctccgggcgcgct
gtgctcgtccccggctga

DBGET integrated database retrieval system