KEGG   Saccharopolyspora erythraea: SACE_2802Help
Entry
SACE_2802         CDS       T00492                                 

Definition
cytochrome P450 hydroxylase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_2802
  Amino acid metabolism
   00380 Tryptophan metabolism
    SACE_2802
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACE_2802
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SACE_2802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(3065572..3066867)
Genome map
AA seq 431 aa AA seqDB search
MLGTRTVRPPGPKGRWLVGNTLDYDRDRMAFLVRCRQEYGDVFSFDERTIVVLDPGLVHD
LLTRTNDDFHSESVPLATRIDPERAAADAQAWMTARRKGWHGLNRAVAQAHAGRLRLLFE
QTLAETRGETVDVLPVMERFAGLATADFCLGADADGMAEILTENVRAIEPLGGSSQLFPA
WWPSRHIRRFLRAREGTLNAVTERIHRRRDKPPADHPQDLLDVLLAAGEPELTEQQVQLL
LRGIMLAAFGVPATALTWLVWTLASRPDLHRRVAEEAAAWPGEEAPPLSALPQTEAVVKE
VLRLWPPTWLIGRTARRGTTLGEWQLRPDDHVMFSPYLMHRDPRWWTDPDELTPDRWLDP
ARTPKRHTYIPFGAGPRVCVGTQLGMIQLCLAAHWLTRNHEIRPTTETCAPKFHDLLLPQ
GFRARFTPRTP
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcacacgcacggtgcggccacccgggccgaaaggccgctggctggtcggcaac
acgctggactacgaccgcgaccgaatggcgttcctggtccgctgccggcaggagtacggc
gacgtcttctccttcgacgagcgcacgatcgtggtgctcgaccccggcctggtgcacgac
ctgctcacccgcaccaacgacgacttccacagcgagagcgtcccgctggcgacccgcatc
gaccccgagcgcgccgcggcggacgcccaggcgtggatgacggcccggcgcaagggctgg
cacgggctcaaccgggctgtcgcccaggcccacgcgggccgtctgcggctgctgttcgag
cagaccctcgccgaaacacgcggggaaacggtggatgtcctgcccgtcatggagcggttc
gcgggcctcgcgaccgccgacttctgcctcggcgccgacgccgacggcatggccgagatc
ctcaccgagaacgtgcgggcgatcgagccgctgggcggcagctcccagctgttcccggcc
tggtggccgtcccgccacatccgccgcttcctgcgggcgcgcgagggcacgctaaacgcg
gtgacggaacggatccaccggcgccgcgacaagccgcccgccgaccacccgcaggacctg
ctggacgtgctgctcgcggcgggcgagccggagctgaccgaacagcaggtgcagctcctg
ctccgcggcatcatgctggccgcgttcggagtgccggccaccgcgctgacctggctggtg
tggacgctggcgtcccggcccgacctgcaccgccgcgtcgccgaggaagcggcggcctgg
ccaggcgaggaagcaccgccgctgtcggcgctgccgcagaccgaggcggtggtcaaggaa
gtcctgcgcctgtggccgccgacctggctgatcggccgcacggcccgccgcgggaccacc
ctcggcgagtggcagctgcgcccggacgaccacgtgatgttcagcccctacctgatgcac
cgcgacccccgctggtggaccgacccggacgagctgaccccggaccgctggctggacccg
gcgagaaccccgaagcgccacacctacatcccgttcggggcgggcccccgcgtctgcgtt
ggcacccaactgggcatgatccagctgtgcctggccgcccactggctcacccggaaccac
gaaatccgccccacgacggaaacctgcgcaccgaagttccacgacctcctgctcccgcaa
gggttccgcgcccgcttcacgccccggaccccctga

DBGET integrated database retrieval system