KEGG   Saccharopolyspora erythraea: SACE_2851Help
Entry
SACE_2851         CDS       T00492                                 

Definition
acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SACE_2851
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2851
   00620 Pyruvate metabolism
    SACE_2851
   00640 Propanoate metabolism
    SACE_2851
  Energy metabolism
   00680 Methane metabolism
    SACE_2851
Enzymes [BR:sen01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SACE_2851
Lipid biosynthesis proteins [BR:sen01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SACE_2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
3111285..3113351
Genome map
AA seq 688 aa AA seqDB search
MATHGDLRRLLAPERIAVVGGDAAAEAVRQCRRIGFGGEIWPVNPRRTEVAGLECHPDVA
SLPGVPDAAFVAVPGRATVEVVAELAALGCGGAVCHASGFAEHGGVALQQWLVAAAGTMP
LIGPNCIGTLNYLDGVAMWPDQHGGRRVDSGVAVITQSGNIGQNLTMQRRSLPLAQLVTL
GNAAVTGVADLVAAMLEDPRITAIGLHLEGIDDAAGLADVALEALRRRVPVVVLKSGSSE
LGARANLSHTSSLAGPDVLCDALFRRCGMARVHEIGAFVETLKFLHVHGALAGTRFASAS
CSGGEAALVADLADERGLPLPEFPEVVRRGLRRVLGERVAVANPLDYHTYVWGRRDELTE
CFTAFLGAGFDTHLLLLDFPREDRCSGESWSVAAEAYVEAHRRTGASACVVSWLPEGMPE
AVGDRLLGEGIAAMQGVADCLDAIGAAARIGAAQDAVDRILPVRTAFRVRTVEPAGSDGV
VHLLDEWAGKRALAEHGLPVPAGVVTGARDAADAAARLGFPVVVKALGVAHKSDVGGVRV
GLTDERQVREAVDGMSGVAERFLVERMVGGAVAELIVGVRRDPLFGTALTVGAGGVLVEL
VADAVTLLLPASPADVRDALRGLRIWPLLAGFRGPGADVDAVVDAVGAIADYAHGTDDLV
ELDVNPLLALPEGTAAVDVLIRRRGGNP
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
gtggccacgcatggggacctgcgcaggctgctcgcacccgagcgcatcgccgtcgtcggc
ggcgatgccgcggccgaggcggtgcggcagtgccgccggatcgggttcggcggcgagatc
tggccggtgaacccccggcggaccgaggtcgcgggactcgagtgccacccggacgtcgcg
tcgctgcccggcgtgcccgacgccgcgttcgtcgcggtgcccggacgagcgacggtcgag
gtggtggccgagctggccgccctcggttgcggtggcgcggtctgccacgcgtcggggttc
gccgagcacggcggagtggcgttgcagcagtggctcgtggcggccgcggggacgatgccg
ctgatcgggcccaactgcatcggcacgctcaactacctcgacggcgttgcgatgtggccg
gatcagcacggcggtcgccgggtggacagcggcgtcgcggtgatcacccagagcggcaac
atcggccagaacctcaccatgcagcgccgttcgctgccgctggcccagctggtcaccctc
ggcaacgcggccgtgaccggggtggccgacctcgtcgcggcgatgctggaggacccgcgg
atcaccgcgatcggcctgcacctggaaggcatcgacgacgccgcgggcctggccgacgtg
gcgctggaagcgctgcgcaggcgggttccggtggtggtgctcaagtccggcagctccgag
ctgggcgcgcgggccaacctcagccacacgagctcgctcgcgggtccggacgtgctctgc
gacgcgctgttccggcgttgcggcatggccagggtgcacgagatcggcgcgttcgtggag
acgctgaagttcctccacgtccacggtgccctggcgggaacccgcttcgcctccgcgagc
tgctccgggggagaggccgcgctcgtcgccgacctggccgacgagcgcggactgccgctg
ccggagttcccggaggttgtacgccgggggctgcggcgggtcctgggcgagcgggtcgcg
gtggccaacccgctcgactaccacacctacgtctggggtcggcgggacgagctgaccgag
tgcttcacggcgttcctcggcgcgggcttcgacacccacctgctgctgctcgacttcccg
cgcgaggaccgctgctcgggcgagtcgtggtcggtcgccgcggaggcctacgtcgaggcg
catcgccgcaccggggcgtccgcctgcgtcgtgagctggctgcccgaggggatgcccgag
gcggtgggggaccggctcctcggcgagggcatcgctgcgatgcagggcgtggccgactgc
ctggacgcgatcggcgccgcggcgcggatcggcgcggcccaggacgcggtggatcggatt
cttcccgtgcggacggcttttcgggtgcggacggtggaaccggccggctctgacggcgtg
gtgcacctgctcgacgagtgggcgggcaagagggcgctggccgagcacgggctcccggtg
cccgcgggcgtcgtgaccggtgcccgcgatgccgcggacgccgcagccaggctgggattc
ccagtggtggtcaaagcgttgggggtcgcgcacaagagcgacgtcggtggtgtccgggtc
gggctgaccgacgagcgccaggtgcgggaggcggtcgacggcatgtccggggtcgcggag
cgcttcctggtggagcgcatggtcggcggtgccgtcgcggagctgatcgtcggcgtgcgg
cgcgatccgctcttcgggacggcgttgaccgtcggcgcaggcggagttctggtcgagctg
gtcgccgacgcggtcacgctgctgctgccggcctccccggccgacgtccgcgacgcgctg
cgcggcctgcggatctggccgctgctggcgggttttcgcggtccgggcgccgatgtggac
gcggtggtcgacgcggtcggcgcgatcgccgactacgcgcacggcaccgacgacctggtc
gaactcgacgtgaacccgctgctggccctgccggagggcaccgcggcggtggacgtgctc
atccggcgacgaggaggcaacccatga

DBGET integrated database retrieval system