KEGG   Saccharopolyspora erythraea: SACE_2945Help
Entry
SACE_2945         CDS       T00492                                 

Definition
(GenBank) putative zinc-containing dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00071  Fatty acid degradation
sen00350  Tyrosine metabolism
sen00625  Chloroalkane and chloroalkene degradation
sen00626  Naphthalene degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_2945
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_2945
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_2945
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_2945
   00626 Naphthalene degradation
    SACE_2945
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_2945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N 2-Hacid_dh_C Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: CAM02223
Cambridge: SACE_2945
Kitasato: SACE_2945
UniProt: A4FDU8
Position
complement(3228327..3229352)
Genome map
AA seq 341 aa AA seqDB search
MRELTYVARHSAEWREVADPVIESGDDAVVAPVAATPCDVDSAILAGHGPIAPPFAIGHE
CVARVVEVGDSVRGVAPGDLVVVPWTICCGQCEPCRGGLSAHCASVPHMAMFGAPIGGSW
GGLFSDLVRVPWAEAMLVPLPTGPDPVAMASASDNWSLAWRLVAPHLRARQGARVLVVAR
GSIGLYVCDIARALGAGDVLYVDPDPAHRALAEQYGARTAEEIEPVRHGFDLAVEATGRV
DQLALALRSLSPEGFCESAGNHFRPGELPLFDMYLTGVTMRIARDNVRVHIPDALELAAS
GRVDPGRVVSDVLDWERLPEALPQRHLKPVFVRDLPQADDA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagctcacctacgtcgccaggcacagcgcggagtggcgggaggtcgccgacccg
gtgatcgagtccggcgacgacgcggtcgtggcaccggtcgcggccacgccatgcgacgtc
gactccgcgatcctggcaggccacggccccatcgccccgccgttcgccatcgggcacgag
tgcgtcgcccgcgtcgtggaggtgggcgactccgtccgcggggtcgcacctggcgacctg
gtcgtggtgccgtggaccatctgctgcgggcagtgcgagccctgccgcggcggcctctcg
gcacattgcgcctcggtgccgcacatggcgatgttcggcgcgccgatcggcgggagctgg
ggcgggctgttctccgacctggtgcgggtgccgtgggcggaggcgatgctggtgccgctg
cccaccggccccgacccggtcgcgatggcctcggccagcgacaactggtcgctggcgtgg
cggctggtcgccccgcacctgcgggcgcgccaaggcgcgcgggtgctggtcgtcgcccgc
ggcagcatcggcctctacgtctgcgacatcgcgcgggcgctgggcgcgggcgacgtgctc
tacgtcgatccggaccccgctcaccgggctctcgccgagcagtacggggcgcgcaccgcc
gaggagatcgagccggtccgccacggtttcgacctggcggtggaggccaccggcagggtg
gaccagctcgcgctcgccctgaggtcgctgtcgccggaggggttctgcgagagcgcgggc
aaccacttccgccccggcgaactgccgctgttcgacatgtacctcaccggcgtcacgatg
cgcatcgcccgcgacaacgtccgcgtccacatccccgacgccctcgagctcgccgcttcc
ggacgcgtcgaccccggccgggtcgtgtccgacgtgctggactgggagcggctgccggag
gccttgccgcaacgccacctcaagccggtcttcgtccgcgacctgccgcaggccgacgat
gcctga

DBGET integrated database retrieval system