KEGG   Saccharopolyspora erythraea: SACE_3084Help
Entry
SACE_3084         CDS       T00492                                 

Gene name
echA5
Definition
(GenBank) enoyl-coA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00071  Fatty acid degradation
sen00280  Valine, leucine and isoleucine degradation
sen00281  Geraniol degradation
sen00310  Lysine degradation
sen00360  Phenylalanine metabolism
sen00362  Benzoate degradation
sen00380  Tryptophan metabolism
sen00410  beta-Alanine metabolism
sen00627  Aminobenzoate degradation
sen00640  Propanoate metabolism
sen00650  Butanoate metabolism
sen00903  Limonene and pinene degradation
sen00930  Caprolactam degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01212  Fatty acid metabolism
Module
sen_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SACE_3084 (echA5)
   00650 Butanoate metabolism
    SACE_3084 (echA5)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_3084 (echA5)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SACE_3084 (echA5)
   00310 Lysine degradation
    SACE_3084 (echA5)
   00360 Phenylalanine metabolism
    SACE_3084 (echA5)
   00380 Tryptophan metabolism
    SACE_3084 (echA5)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SACE_3084 (echA5)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SACE_3084 (echA5)
   00281 Geraniol degradation
    SACE_3084 (echA5)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SACE_3084 (echA5)
   00627 Aminobenzoate degradation
    SACE_3084 (echA5)
   00930 Caprolactam degradation
    SACE_3084 (echA5)
Enzymes [BR:sen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SACE_3084 (echA5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 GntR
Motif
Other DBs
NCBI-ProteinID: CAM02362
Cambridge: SACE_3084
Kitasato: SACE_3084
UniProt: A4FE87
Position
complement(3391249..3392031)
Genome map
AA seq 260 aa AA seqDB search
MASEEPVLVHRESAVTTISLNRPEVRNAVDRDAAEALAAAFRAFDADEEASVAVLHGEGG
TFCSGADLKAISAGRGNRLAPDGDGPMGVSRMRLSKPVIAAVAGHAVAGGLELALWADLR
VADETAVFGVFCRRWGVPLVDGGTVRLPRLVGAGTAMDLVLTGRPVDAAEALRIGLANRV
VAAGQALPEAQRLARQIAGFPQPCMRNDRMSLLEQEGLDERAAMADEFARGMASLSGDGL
DGAARFAEGAGRHGSFESPE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgaggagcccgtgctggtccaccgcgagagcgcggtgacaacgatcagcctg
aaccgtcccgaggtccgcaacgccgtcgaccgggacgcggccgaggcgctcgcggccgct
ttccgggccttcgacgccgacgaagaggcttcggtggccgtgctgcacggcgagggcggg
accttctgctcgggtgcggacctgaaggcgatcagcgccgggcggggcaaccggctcgcc
ccggacggtgacgggccgatgggcgtgtcccggatgcggctgtcgaaaccggtgatcgcc
gccgtcgccgggcacgccgtggcgggcgggctggagctggcgctgtgggcggacctgcgg
gtggccgacgagaccgcggtcttcggcgtgttctgccgccgctggggcgtgccgctcgtc
gacggcggcaccgtccggctgccccggctggtcggggcgggcaccgcgatggacctggtg
ctcaccggacggccggtcgacgcggccgaggcgctgcggatcgggctcgcgaaccgcgtg
gtcgcggccgggcaggcgttgccggaggcgcagcgcctcgcccggcagatcgcgggattc
ccccagccctgcatgcgcaacgaccggatgtccctgctggagcaggaaggtctcgacgag
cgggccgcgatggccgacgagttcgcccggggcatggcgtcgctgtcgggcgacggcctc
gacggagcggcccgcttcgccgagggcgccgggcgtcacggctccttcgaaagcccggag
tga

DBGET integrated database retrieval system