KEGG   Saccharopolyspora erythraea: SACE_3215Help
Entry
SACE_3215         CDS       T00492                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sen00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
3552963..3554312
Genome map
AA seq 449 aa AA seqDB search
MTPDLDVAVVGAGIAGLTAAHELQRAGLAVRVYEAEPHVGGRMASFRYEGYTIDQGAEQI
SPHGYRATWELLRRLGVPLDDIPLIGKSIGMWRDGRAHPGVAERRALLTGAGLSPRARLD
LARFLAWASRRRREFDPDHPEATPAGEATVAAFARRYHPDLHDYLFQPVAGSFFGWDTTR
SAAASMLSLLVAVGDAASWRTYRDGMDTLALRLARELDVVVGRMVGEVVADRDSARLSVG
GEVVTARTVLLCVPAPIAARLHANPPAAELAFLRACTFTPALKVSCLLDRPLTPESSRPL
YVLLTPEAEDDVLSGIIVDHAKHPGRAPAGRGLLSLMANARTIPSLLEAPEQEVVARLTA
AVPRYLPGFGSANVANFVHGFRYGLPEATPAALRARAGFMARPVRPVDYAGDWVMLRPAS
EGAVRAGALAASRTLSRLGASRPAARTAA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggatctggacgtggccgtggtcggtgccggcatcgccgggctgaccgcagcg
cacgaactgcagcgggccgggctcgccgtccgggtctacgaggccgagccgcacgtcggc
ggcaggatggcgagcttccgctacgagggctacacgatcgaccagggcgccgagcagatc
tccccgcacggctaccgcgcgacgtgggagctgctgcgcaggctgggtgtgccgctcgac
gacatcccgttgatcggcaagtccatcggcatgtggcgcgacgggcgcgcgcatcccggt
gtcgccgaacgccgcgcgctgctgaccggtgccgggctgtccccgcgggcccggctggac
ctggcgcggttcctggcctgggcgtcgcggcgcaggcgcgagttcgacccggaccacccc
gaggccacacccgcgggcgaggccacggtcgccgcgttcgcccggcgctaccaccccgac
ctgcacgactacctgttccagccggtggcgggcagcttcttcggctgggacaccacgcgt
tcggccgcggcgtcgatgctgagcctgctggtcgcggtcggcgacgccgcgtcctggcgc
acctaccgggacggcatggacaccctcgcgctgcggctggcccgcgagctcgacgtggtg
gtcgggcgcatggtcggcgaggtggtcgccgaccgcgactccgcccgcctgtcggtcggc
ggcgaggtggtgacggcgcgcacggtgctgctgtgcgtacccgcgccgatcgcggcgcgg
ctgcacgccaacccgcctgccgccgagctggcgttcctgcgggcctgcacgttcaccccg
gcgctgaaggtgagctgcctgctcgaccgcccgctcacaccggagtcgagcaggccgctg
tacgtgctgctgacaccggaggccgaggacgacgtgctctccggcatcatcgtcgaccac
gccaagcaccccggccgggcgccggcgggccggggactgctcagcctgatggccaatgcc
aggaccatcccgtcgctgctggaggcaccggagcaggaggtcgtcgcgcggctcaccgcc
gccgttccgcgctacctgcccgggttcgggtcggccaacgtcgccaacttcgtccacggc
ttccgctacgggctgcccgaagccactccggcggcgctgcgggcgcgcgccgggttcatg
gcgcggcccgtccgtccggtcgactacgccggtgactgggtgatgctgcgtcccgcgagc
gagggagccgtgcgcgcgggcgcgctcgcggcgtcccgaaccctcagcaggctcggcgcg
tcgcgaccggccgcacgaaccgccgcatag

DBGET integrated database retrieval system