KEGG   Saccharopolyspora erythraea: SACE_3215Help
Entry
SACE_3215         CDS       T00492                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SACE_3215
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SACE_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
3552963..3554312
Genome map
AA seq 449 aa AA seqDB search
MTPDLDVAVVGAGIAGLTAAHELQRAGLAVRVYEAEPHVGGRMASFRYEGYTIDQGAEQI
SPHGYRATWELLRRLGVPLDDIPLIGKSIGMWRDGRAHPGVAERRALLTGAGLSPRARLD
LARFLAWASRRRREFDPDHPEATPAGEATVAAFARRYHPDLHDYLFQPVAGSFFGWDTTR
SAAASMLSLLVAVGDAASWRTYRDGMDTLALRLARELDVVVGRMVGEVVADRDSARLSVG
GEVVTARTVLLCVPAPIAARLHANPPAAELAFLRACTFTPALKVSCLLDRPLTPESSRPL
YVLLTPEAEDDVLSGIIVDHAKHPGRAPAGRGLLSLMANARTIPSLLEAPEQEVVARLTA
AVPRYLPGFGSANVANFVHGFRYGLPEATPAALRARAGFMARPVRPVDYAGDWVMLRPAS
EGAVRAGALAASRTLSRLGASRPAARTAA
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggatctggacgtggccgtggtcggtgccggcatcgccgggctgaccgcagcg
cacgaactgcagcgggccgggctcgccgtccgggtctacgaggccgagccgcacgtcggc
ggcaggatggcgagcttccgctacgagggctacacgatcgaccagggcgccgagcagatc
tccccgcacggctaccgcgcgacgtgggagctgctgcgcaggctgggtgtgccgctcgac
gacatcccgttgatcggcaagtccatcggcatgtggcgcgacgggcgcgcgcatcccggt
gtcgccgaacgccgcgcgctgctgaccggtgccgggctgtccccgcgggcccggctggac
ctggcgcggttcctggcctgggcgtcgcggcgcaggcgcgagttcgacccggaccacccc
gaggccacacccgcgggcgaggccacggtcgccgcgttcgcccggcgctaccaccccgac
ctgcacgactacctgttccagccggtggcgggcagcttcttcggctgggacaccacgcgt
tcggccgcggcgtcgatgctgagcctgctggtcgcggtcggcgacgccgcgtcctggcgc
acctaccgggacggcatggacaccctcgcgctgcggctggcccgcgagctcgacgtggtg
gtcgggcgcatggtcggcgaggtggtcgccgaccgcgactccgcccgcctgtcggtcggc
ggcgaggtggtgacggcgcgcacggtgctgctgtgcgtacccgcgccgatcgcggcgcgg
ctgcacgccaacccgcctgccgccgagctggcgttcctgcgggcctgcacgttcaccccg
gcgctgaaggtgagctgcctgctcgaccgcccgctcacaccggagtcgagcaggccgctg
tacgtgctgctgacaccggaggccgaggacgacgtgctctccggcatcatcgtcgaccac
gccaagcaccccggccgggcgccggcgggccggggactgctcagcctgatggccaatgcc
aggaccatcccgtcgctgctggaggcaccggagcaggaggtcgtcgcgcggctcaccgcc
gccgttccgcgctacctgcccgggttcgggtcggccaacgtcgccaacttcgtccacggc
ttccgctacgggctgcccgaagccactccggcggcgctgcgggcgcgcgccgggttcatg
gcgcggcccgtccgtccggtcgactacgccggtgactgggtgatgctgcgtcccgcgagc
gagggagccgtgcgcgcgggcgcgctcgcggcgtcccgaaccctcagcaggctcggcgcg
tcgcgaccggccgcacgaaccgccgcatag

DBGET integrated database retrieval system