KEGG   Saccharopolyspora erythraea: SACE_3234Help
Entry
SACE_3234         CDS       T00492                                 

Gene name
rbsK
Definition
(GenBank) sugar kinase in PfkB family
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SACE_3234 (rbsK)
Enzymes [BR:sen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SACE_3234 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF3203
Motif
Other DBs
NCBI-ProteinID: CAM02509
Cambridge: SACE_3234
Kitasato: SACE_3234
UniProt: A4FEN4
Position
3578520..3579449
Genome map
AA seq 309 aa AA seqDB search
MPRAATTAPELVVVGSLNADLTARVRRHPAPGETVRGDALTVSGGGKGANQAVAAARLGA
RTAMVGRVGADAHGDMLLEALRADGVDTTHTMRDHGAPTGTALITVADSGENNIIVCAGA
NERLSPHVVEAAEAVIGAARVVSLVLEVPVATVVAAARAASEAGTRVVLNLSPVVELPPE
VLALADPLVVNEHEARQLLAAGAPDDDRGLSTALLALGVRSAVVTLGERGAVVAESGRVE
HVPAVPTDAVDTTGAGDAFAATAAWRLGRGDALPDAARWASRVSARCVREPGAQPSYPTL
DAVAEAARC
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtgccgcgacaaccgcgcccgagctggtggtggtcggttcgctgaacgccgac
ctgaccgcgcgggtgcgccgccatcccgcgccgggggagaccgtgcggggcgacgcgctg
accgtcagcggtggcggcaagggcgccaaccaggccgtggccgccgcccggctcggtgcc
cgcaccgccatggtcggccgcgtgggcgcagacgcccacggcgacatgctgctcgaagcg
ctgagagccgatggcgtggacaccactcacaccatgcgcgaccacggcgccccgaccggg
acagcgttgatcacggtggcggactcgggcgagaacaacatcatcgtgtgcgcgggcgcg
aacgagcggctgtcgccgcacgtcgtcgaagccgccgaggccgtgatcggcgcggcgcgg
gtcgtttcgctggtcctggaggtgccggtcgccacggtcgtcgcggcggcccgcgcggcg
agcgaggcgggcacccgggtggtgctgaacctgtcgccggtcgtcgagctgccgccggag
gtgctggcgctggcggacccgctggtcgtcaacgagcacgaggcccggcagctcctggcc
gcgggcgccccggatgacgaccgggggctctcgaccgcgctgctcgcgctcggcgtccgg
tcggccgtggtcaccctcggcgagcgaggtgccgtcgtggccgagtccggccgcgtcgag
cacgtaccggcagtacccaccgacgccgtcgacaccaccggcgccggtgacgccttcgcc
gccaccgcggcctggcgtctgggccgaggcgacgcgctgcccgacgcggcccgttgggcg
agtcgcgtgagcgcccgctgcgtgcgcgaacccggcgcgcaaccgtcctatcccacgctg
gacgccgtggccgaggcagcgcgctgctga

DBGET integrated database retrieval system