KEGG   Saccharopolyspora erythraea: SACE_3353Help
Entry
SACE_3353         CDS       T00492                                 

Definition
helicase RecD/TraA (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sen  Saccharopolyspora erythraea
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sen03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
3702814..3705081
Genome map
AA seq 755 aa AA seqDB search
MAGREPGAVRGQPGAPNGQVSAPARGAVLEGTLERITFANEETGYTVARVDTGRGGDLVT
VVGALLGAQPGEALRMRGRWGSHPQYGRQFHVDDYATVLPATVQGIRRYLGSGLIKGIGP
KLAEKIVEHFGTAALDVIEQEPQRLVEVPKLGPKRTRLIAEAWEEQKAIKEVMVFLQGVG
VSTSLAVKIYKQYTDDAIRVVKEEPYRLAGDVWGIGFKTADTIAKAVGIPHDSPQRVKAG
LQFTLSESTGEGNCFLPETELIAEAVKILTVDTGLVIECLAELVEEEGVVREEIPGEDAE
VPTAAIYLVPFHRAEVALAAQLTRLLRTSADRMPAFASVDWDKAMGWLRRTTGAELAEGQ
ERAVRLALTEKVAVLTGGPGCGKSFTVRSIVELARAKRAKVVLAAPTGRAVKRLTELTGH
EAATVHRLLQLQPGGDAAFDRDNPLDADLVVVDEASMLDLLLANKLAKAVPAGAHLLLVG
DVDQLPSVGAGEVLRDLLAEGTPIPHVGLNEVFRQAAESGVVTNAHRINAGEHPRTHGLD
DFFLFQVDEPDVTAELTVDVVARRIPRRFGLNPRTDVQVLAPMHRGPAGAGALNQLLQDA
ITPGRPGLPERRFGGRVFRVGDKVTQIRNNYDKGASGVFNGTQGVVSALDEEAQTLTVRT
DEDEDVDYDFAELDELVHAYAVTIHRSQGSEYPCVVIPLTTSAWMMLQRNLLYTAVTRAK
KLVVLVGSKKALGQAVRAVGSGRRHTALDHRLRAA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggccgcgagccgggcgcggtgcgcgggcagcccggcgcgccgaacgggcaggta
agcgcgcccgcccgtggcgcggtgctcgaaggcacgctggagcgcatcaccttcgccaac
gaggagaccggctacacggtggcccgggtcgacaccggtcgcggcggcgacctcgtgacg
gtcgtcggcgcgctgctgggcgcccagcccggggaagcgctgcggatgcgcgggcggtgg
ggttcgcacccgcagtacggccgccagttccacgtcgacgactacgccacggtgctgccc
gccaccgtgcagggcatccggcgctacctgggttccgggctgatcaagggcattgggccc
aagctcgccgagaagatcgtcgagcacttcggcaccgccgccctcgatgtcatcgagcag
gagccgcagcggctcgtcgaggttcccaagctcggcccaaagcgcaccaggctgatcgcc
gaggcgtgggaggagcagaaggcgatcaaggaggtgatggtcttcctccagggtgtcggc
gtgtcgacctcgctggccgtcaagatctacaagcagtacaccgacgacgcgatccgcgtc
gtgaaggaggagccctaccggctggccggtgacgtgtgggggatcgggttcaagaccgcc
gacacgatcgccaaggcggtcggcatcccgcacgactcgccgcagcgggtcaaggcgggc
ctgcagttcacgctttcggagtccaccggcgagggcaactgcttcctgcccgagaccgag
ctgatcgccgaagcggtgaagatcctgaccgtcgacaccggtctggtgatcgaatgcctc
gccgagctcgtcgaggaggaaggcgtggtccgggaggagatcccgggcgaggacgccgag
gtgccgaccgcggcgatctacctggtgcccttccaccgggccgaagtggcgttggcggcc
cagctgacgcggctgctgcgcaccagcgccgaccggatgcccgccttcgcctccgtggac
tgggacaaggcgatgggctggctgcgccgcaccaccggggccgaactggccgaaggccag
gagcgggcggtgcggctggcgctgaccgagaaggtcgcggtgctgaccggtggtccgggc
tgcggcaagagcttcacggtgcgctcgatcgtcgagctggccagggcgaagcgggcgaag
gtggtgctggcggcgccgaccggccgggccgtcaagcgcctcaccgagctgaccggccac
gaggccgccaccgtgcaccggctcctgcagctccagcccggcggggacgccgcgttcgac
cgcgacaacccgctcgacgccgacctggtcgtggtcgacgaggcgtccatgctcgacctg
ctgctggccaacaagctcgccaaggcggtccccgccggagcgcacctgctgctggtcggc
gacgtcgaccagctcccgtcggtcggcgcgggcgaggtgctgcgcgacctgctcgccgag
gggacgccgatcccgcacgtggggctgaacgaggtgttccgccaggccgcggagtccggc
gtggtcaccaacgcgcaccggatcaacgccggcgagcacccgcgcacgcacggcctcgac
gacttcttcctgttccaggtcgacgagcccgacgtcaccgccgagctgacggtcgacgtc
gtcgcgcggcgcatcccgcgcaggttcggtctcaacccccgcaccgacgtgcaggtcctg
gcgccgatgcaccgcgggccggccggggcgggcgcgctgaaccagctcttgcaggacgcg
atcacgcccggcagaccgggcctgcccgagcggaggttcggcggccgggtgttccgggtc
ggcgacaaggtcacccagatccgcaacaactacgacaagggcgccagcggcgtcttcaac
ggcacgcagggcgtagtgagcgcgctggacgaagaggcccagacgctcacggtgcgcacc
gacgaggacgaggacgtcgactacgacttcgccgagctggacgagctcgtgcacgcctac
gccgtcacgatccaccgctcgcagggcagcgagtacccgtgcgtggtgatcccgctgacc
accagcgcctggatgatgttgcagcgcaacctgctctacacggcggtgaccagggcgaag
aagctggtggtgctggtcgggtcgaagaaggcgctcggtcaggcggtgcgcgcggtcggc
tccggccgccgccacaccgcgctggaccaccggctgcgcgcggcgtga

DBGET integrated database retrieval system