KEGG   Saccharopolyspora erythraea: SACE_3529Help
Entry
SACE_3529         CDS       T00492                                 

Gene name
cysQ
Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sen  Saccharopolyspora erythraea
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SACE_3529 (cysQ)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SACE_3529 (cysQ)
Transfer RNA biogenesis [BR:sen03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SACE_3529 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
3888917..3889678
Genome map
AA seq 253 aa AA seqDB search
MTDNDHVLAARLAEAAGRHLVDLRGRGDPADPKALGEAGDRGAHELLLAELTEQRPADTV
LSEHGTAGPPRRADGRTWIVDPLDGTREFGERDRQDWAVHVALAQGRRLVAGAVALPARD
VVLSTADPPRHFDSGGARPRIAVSRTRPPAFVETLTEALGAVTVPLGSAGAKIAAVVLGD
VDAYVHAGGQYEWDSAAPIAVARAAGMHTSRLDGSELVYNRPDPWLPDLVVCRPALAEPL
LAELARLERAGEA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgacaacgaccacgtgctggcggcgcggctggccgaggcggcgggccgccacctc
gtcgacctgcgcgggcgcggtgacccggccgacccgaaggcgctgggcgaggcgggggac
cggggagcgcacgaactgctcctggcggagctgaccgagcagcgccccgccgacacggtc
ctgtccgagcacggcaccgccggcccgccgcggcgggcggacggccgcacctggatcgtc
gatcccctcgacggcaccagggagttcggcgagcgtgacaggcaggactgggcggtgcac
gtcgcgctcgcgcagggccggcggctggtggccggggcggtggccctgcccgcccgggac
gtggtgctcagcaccgccgacccgccgcggcacttcgactccgggggcgcgcggccccgc
atcgcggtgagccgcacccgcccgccggcgttcgtcgagacgctgaccgaagccctcggt
gcggtcacggtgccgctggggtcggccggggcgaagatcgccgcggtcgtgctcggcgac
gtcgacgcctacgtccacgcgggtggccagtacgagtgggacagcgccgcgccgatcgcg
gtggccagggccgccgggatgcacacctcgcggctggacggctcggagctggtctacaac
cggcccgatccgtggctgcccgacctggtggtgtgccgtcccgcgctggcggagccgctg
ctggccgaactggcgcggctggagcgggcgggggaggcgtga

DBGET integrated database retrieval system