KEGG   Saccharopolyspora erythraea: SACE_3605Help
Entry
SACE_3605         CDS       T00492                                 

Definition
oxidase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sen  Saccharopolyspora erythraea
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sen00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(3966066..3966638)
Genome map
AA seq 190 aa AA seqDB search
MSLLTVWPDTDAGTVELRTEDPQEITDVLKQFGVSFSRWELRELPERPSSEEVLEAYRAE
VDEVIEREGYIKVDAAVMAPSQDPQWPAQAKAAREKFLSEHTHDDDEDRFFARGAGVFYL
HIGDRVYAMLCEAGDLLSVPANTTHWFDMGTEPDFVAIRFFHDDDGWVGAFLNTDTAEKF
PTFDELMASR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgctgaccgtgtggcccgacaccgatgcgggcacggtggagttgcgcaccgag
gatccgcaggagatcaccgacgtgctcaagcagttcggggtgagcttcagccgctgggag
ctgcgggagctgccggagcggccgtcctcggaggaggtgctggaggcctaccgggccgag
gtggacgaggtcatcgagcgcgagggctacatcaaggtcgacgcggcggtgatggcgccg
tcgcaggacccgcagtggccggcccaggccaaggcggcgcgggagaagttcctgtccgag
cacacccacgacgatgacgaggaccggttcttcgcccgcggtgccggggtgttctacctg
cacatcggggaccgggtgtatgcgatgttgtgcgaggcgggcgatctgctgagcgtgccc
gccaacaccacgcactggttcgacatgggcaccgagccggatttcgtggcgatccgcttc
ttccacgacgacgacggctgggtcggtgcgttcctcaacaccgacaccgccgagaagttc
ccgactttcgacgagttgatggcttcgcggtag

DBGET integrated database retrieval system