KEGG   Saccharopolyspora erythraea: SACE_3669Help
Entry
SACE_3669         CDS       T00492                                 

Definition
two-component system response regulator (EC:3.1.1.61)
Orthology
K05971  
[EC:3.1.1.61]
Organism
sen  Saccharopolyspora erythraea
Brite
Enzymes [BR:sen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SACE_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
4026976..4027581
Genome map
AA seq 201 aa AA seqDB search
MTRILVADDEHLIRNAIAGLLELEDGFEVVGQAASGDEALATALRVRPDVALLDLQLPGP
DGIEVARRLAAQLPECRSIIVTSHARPGYLKSALAAGARGFLPKTVSPRTLAQVVRTVVG
GGRHVDPELAAEAISAGDSPLSPREADVLALARDGAPVEEIARRVSLSRGTVRNHLAAAI
AKLDAANRHEAARIAAGHGWI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatcctcgtcgccgacgacgaacacctcatccgcaacgccatcgccgggctg
ctcgagctcgaggacggcttcgaggtcgtcggccaggccgcgtccggtgacgaggcgctg
gccacggccctgcgggtccgtcccgacgtggccctgctcgacctgcagctgcccgggccc
gacggcatcgaggtcgcccggcggctcgcggcgcagctgccggagtgccggagcatcatc
gtgacctcgcacgctcggcccgggtatctgaagtcggcactcgcggcgggcgcgcgcggc
ttcctgcccaagaccgtctcccctcggaccctcgcgcaggtcgtccgcacggtcgtgggc
ggcggccgccacgtcgaccccgagctcgcggccgaggcgatcagcgcgggcgactccccg
ctcagcccgcgcgaggccgacgtcctcgccctggcacgcgacggcgcgcccgtcgaagag
atcgctcggcgcgtctcgctctcccgggggaccgtgcgcaaccacctcgcggccgccatc
gcgaagctcgacgccgccaaccggcacgaggccgcgcgcatcgccgccgggcacggctgg
atctga

DBGET integrated database retrieval system