KEGG   Saccharopolyspora erythraea: SACE_3669Help
Entry
SACE_3669         CDS       T00492                                 

Definition
(GenBank) putative two-component system response regulator (EC:3.1.1.61)
  KO
K07693  
two-component system, NarL family, response regulator DesR
Organism
sen  Saccharopolyspora erythraea
Pathway
Two-component system
Module
DesK-DesR (membrane lipid fluidity regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sen00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SACE_3669
Two-component system [BR:sen02022]
 NarL family
  DesK-DesR [MD:M00479]
   SACE_3669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
4026976..4027581
Genome map
AA seq 201 aa AA seqDB search
MTRILVADDEHLIRNAIAGLLELEDGFEVVGQAASGDEALATALRVRPDVALLDLQLPGP
DGIEVARRLAAQLPECRSIIVTSHARPGYLKSALAAGARGFLPKTVSPRTLAQVVRTVVG
GGRHVDPELAAEAISAGDSPLSPREADVLALARDGAPVEEIARRVSLSRGTVRNHLAAAI
AKLDAANRHEAARIAAGHGWI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatcctcgtcgccgacgacgaacacctcatccgcaacgccatcgccgggctg
ctcgagctcgaggacggcttcgaggtcgtcggccaggccgcgtccggtgacgaggcgctg
gccacggccctgcgggtccgtcccgacgtggccctgctcgacctgcagctgcccgggccc
gacggcatcgaggtcgcccggcggctcgcggcgcagctgccggagtgccggagcatcatc
gtgacctcgcacgctcggcccgggtatctgaagtcggcactcgcggcgggcgcgcgcggc
ttcctgcccaagaccgtctcccctcggaccctcgcgcaggtcgtccgcacggtcgtgggc
ggcggccgccacgtcgaccccgagctcgcggccgaggcgatcagcgcgggcgactccccg
ctcagcccgcgcgaggccgacgtcctcgccctggcacgcgacggcgcgcccgtcgaagag
atcgctcggcgcgtctcgctctcccgggggaccgtgcgcaaccacctcgcggccgccatc
gcgaagctcgacgccgccaaccggcacgaggccgcgcgcatcgccgccgggcacggctgg
atctga

DBGET integrated database retrieval system