KEGG   Saccharopolyspora erythraea: SACE_3718Help
Entry
SACE_3718         CDS       T00492                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sen  Saccharopolyspora erythraea
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sen00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sen00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4072278..4073021)
Genome map
AA seq 247 aa AA seqDB search
MDLDDRTALVTGGGAGIGAACARALAEAGAVVHVVDRDGESARAVAAEVGGHAHVADLAV
ADELHGLPREVDVLVNNAGMQHIAPVHEFDPDIFVRMQQVMVTAPFLLARRCLPHMYRRG
WGRVVNVSSVHGLRASTGKSAYVAAKHGLEGLSKTIALEGAAHGVTSNCVNPGYVDTALV
RDQIADQAAAHGTDPEDVVEQVLLTRPAIKRLIDPREVAAAVRWLCGPHSGYVSGASLAL
DGAWSSS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgacgaccgcacggcactggtcaccgggggcggtgcggggatcggcgcggcc
tgcgcgcgggcgctggccgaggcgggggccgtggtgcacgtggtggaccgcgacggcgag
tccgcccgtgcggttgccgccgaggtcggcgggcacgcccacgtggccgatctggccgtg
gctgacgagctgcacggtctgccgcgcgaggtcgacgtgctggtcaacaacgccgggatg
cagcacatcgcgccggtgcacgagttcgacccggacatcttcgtgcggatgcagcaggtg
atggtgaccgccccgttcctgctggcccgccgctgcttgccgcacatgtaccggcggggc
tggggccgggtggtcaacgtctccagcgtccacgggcttcgcgccagcaccggcaagtcg
gcctacgtggccgccaagcacggcctggaagggctgagcaagaccatcgccctggaaggt
gccgcgcacggggtgaccagcaactgcgtcaaccccggctacgtcgacaccgcgctggtg
cgcgaccagatcgccgaccaggccgccgcgcacggcaccgaccccgaagacgtcgtcgag
caggtgctgctgacccgcccggcgatcaaacgcctcatcgatccccgcgaggtcgccgcg
gcggtgaggtggctgtgcggcccgcactccggctacgtctccggcgcgtccctggccctg
gacggggcctggagcagttcctga

DBGET integrated database retrieval system