KEGG   Saccharopolyspora erythraea: SACE_3764Help
Entry
SACE_3764         CDS       T00492                                 

Definition
lysozyme M1 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sen  Saccharopolyspora erythraea
Brite
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SACE_3764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
4118420..4119259
Genome map
AA seq 279 aa AA seqDB search
MAPSRIARSSRYRPRRLLVCALATALTALAPGAHAAYSQTPRLDPGDPNGAWAGYSLGRS
SDTSAPRYAAPAGSVAGMDVSGHQGVVDWRAAWDAGARFAYVKASEGVGFRNKHFPQQYD
GSRGVGMVRGAYHFALPDRSSGAEQAHFFVDNGGGWVPDGHTLPGALDVEHNPYGGACYG
LPPEGMSRWIAEFSDTYRARTGRFPAIYTTTRWWQQCTGGNPSFGANNPLWLARYAPEPG
ALPAGWRFHTIWQFADRGVFPGDQNTFNGGPEQLARFTS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtggccccatctcgcatcgcacgctcttcccggtaccgcccgcgcaggctgctggtctgc
gccctggcaacggcgctgaccgcgctcgctccgggcgcgcacgccgcctactcgcaaaca
ccccggctcgaccccggcgatccgaacggagcgtgggccggctacagcctcggccgcagc
tccgacacgtccgcgccgcggtacgccgcgcccgccggcagcgtcgcgggcatggacgtc
agcggtcaccagggcgtggtcgactggcgggcggcctgggacgccggcgcccgcttcgcc
tacgtcaaggccagcgagggcgtcggcttccgcaacaagcacttcccccagcagtacgac
ggctcgcgcggtgtgggcatggtccgcggcgcctaccacttcgcgctgcccgaccgctcc
agcggcgccgagcaggcccacttcttcgtcgacaacggcggcgggtgggtgcccgacggc
cacaccctgcccggggcgctggacgtcgagcacaacccctacggcggcgcctgctacggg
ctgccgccggaggggatgtcgcggtggatcgccgagttcagcgacacctaccgggcgcgc
accggccggttcccggcgatctacaccacgacgcgctggtggcagcagtgcaccggcggg
aacccttccttcggggcgaacaacccgctgtggctggcccgctacgcgcccgagcccggt
gcgctgcccgcgggctggaggttccacacgatctggcagttcgccgaccggggcgtgttc
cccggtgaccagaacaccttcaacggcggacccgagcagttggcccgcttcacctcctga

DBGET integrated database retrieval system