KEGG   Saccharopolyspora erythraea: SACE_3851Help
Entry
SACE_3851         CDS       T00492                                 

Gene name
hexA
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sen  Saccharopolyspora erythraea
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sen00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sen00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
4214712..4216310
Genome map
AA seq 532 aa AA seqDB search
MKRSSQHLPTRRATSVAALLTGALLTGGLLTAPVAGGVEAQDSRMHQVIPAPAHVEPDPA
VEFSLGEKARISAEGEAKAVGDQLGEILRPSTGFELPVVGADPRPGDIALEIERSDDLGA
EGYRLAVTGENVRIEAGTPAGLFNGVQTLRQLLPASVESDQVQQGPWTVPGGEITDQPRF
GHRAAMLDVARHFFDVEQVKRYIDQISMYKVNRLHLHLSDDQGWRIQIKSWPRLAEYGGS
TEVGGGPGGYYTQQDYTDIVNYAAERHILVVPEIDLPGHTNAALASYAELNCDGVAPPLY
TGIEVGFSSLCVPKEITYEFVDDVLRELSAITPGPYLHIGGDEAHSTSEEDYKTFMGRVL
PMVEKYGKTAVGWHEYAKAEPKAGSVLQYWGTTDSDPLLAPAVARGNKVLLSPANKSYLD
MKYDADTELGLSWAGYIEVATAYRWNPGRYLQGVPEEAVLGVEAPLWSETLENSDHIEFM
AFPRLPAIAELGWSPAATHDWESFRKRLAAQGPRLTALGIDFYRSPQVPWSK
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcatcgcagcacctgccgacccgccgcgcgacgtcggtggcggcgctgctc
accggcgcactgctgaccggcggtctgctgaccgcgccggtcgcgggtggcgtcgaagcc
caggactcccggatgcaccaggtgatccccgccccggcccacgtcgagcccgatcccgcc
gtcgagttctcgctcggcgagaaagcccggatcagcgccgagggcgaggccaaggccgtc
ggcgaccagctcggcgagatcctgcgcccctccaccgggttcgagctgccggtcgtcggc
gccgacccgcgccccggcgacatcgccctcgagatcgagcgctcggacgacctcggcgcc
gagggctaccggttggcggtgaccggggagaacgtgcggatcgaggcgggcacccccgcg
ggcctgttcaacggcgtgcagacgctgcggcagttgctgcccgcctcggtcgagagcgac
caggtgcagcaggggccgtggacggtgcccggcggtgagatcaccgaccagccgcgcttc
ggccaccgcgcggcgatgctggacgtcgcccggcacttcttcgacgtcgagcaggtcaag
cgctacatcgaccagatctcgatgtacaaggtcaaccgcctgcacctgcacctgagcgac
gaccagggctggcggatccagatcaagagctggccgcggctggccgaatacggcggcagc
accgaggtcggcggcggcccgggcggctactacacgcagcaggactacaccgacatcgtc
aactacgccgccgagcgccacatcctcgtggtgcccgagatcgacctgcccggtcacacc
aacgcggcgctggcctcctacgccgagctgaactgcgacggcgtcgccccgccgctctac
accggcatcgaggtcggcttcagctcgctgtgcgtgccgaaggagatcacctacgagttc
gtcgacgacgtgctgcgcgagctttcggccatcacccccggcccgtacctgcacatcggc
ggcgacgaggcgcactcgacgtccgaagaggactacaagacgttcatgggccgggtcctg
ccgatggtcgagaagtacggcaagaccgcggtcggctggcacgagtacgccaaggccgag
ccgaaggcgggttcggtgctgcagtactggggcaccaccgactccgacccgctgctggcc
ccggccgtcgcccgcggcaacaaggtcctgctctccccggcgaacaagtcctacctggac
atgaagtacgacgccgacaccgagctggggctgagctgggcaggctacatcgaggtggcc
accgcctaccgctggaaccccggccggtacctgcagggcgtgccggaggaagcagtgctc
ggcgtggaggctccactgtggagcgagacgctggagaactccgaccacatcgagttcatg
gcgttcccgaggctgcccgccatcgccgagctgggctggtcgccggcggccacccacgac
tgggagtcgttcaggaagcggctggccgcgcaggggccccggctgaccgcgctcgggatc
gacttctaccggtctccgcaggtgccttggtcgaagtga

DBGET integrated database retrieval system