KEGG   Saccharopolyspora erythraea: SACE_3904Help
Entry
SACE_3904         CDS       T00492                                 

Gene name
yihR
Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_3904 (yihR)
   00052 Galactose metabolism
    SACE_3904 (yihR)
Enzymes [BR:sen01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SACE_3904 (yihR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
4282930..4283952
Genome map
AA seq 340 aa AA seqDB search
MSQQRKWTRRSAITAAAGVAAATSLTPTAHARPPAGGGQTALGRLYEIRSGRHRVVVAGV
AATLLSWQVDGTEMLLTHDPSWLGEGYQGKTILPWPNRIESGRYTFGGQQLQVPINEPSR
QAALHGLMSWVEWQPVRHRGDGVVLEHLLHPHYGYPFTLALQIEFTVDGRGVSSRLSAKN
VGDTDAPFGTANHTYIAASGPAIDTMGFELPASTYYVTDDNLIPTGTAPVAGTEYDFRSA
RRIGATKMDTAFTDLARESGGEAVVRFERPGGQHVELWVDRTHGYLQVYTDDSPSQDRPA
RAGITVEPMTCAPNAFVTGDGLITLRPGEVHEGRWGYRIG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcagcgcaagtggacgcggcgcagcgcgatcacggccgcggccggagtcgcc
gctgccacgtcgctgaccccgaccgcgcacgcccggcccccggcgggcggcgggcagacc
gcgctcgggcggctctacgagatccgctccggcaggcaccgggtggtggtcgccggggtc
gccgcgacgctgctgtcgtggcaggtcgacggcaccgagatgctgctcacccacgacccg
tcgtggctcggcgagggctaccagggcaagacgatcctgccctggcccaaccggatcgag
agcggccgctacaccttcggcggtcagcagctgcaggtcccgatcaacgagccgtcgcga
caggccgcgctgcacgggctgatgagctgggtcgagtggcagccggtgcgccaccgcggg
gacggagtggtgctcgaacacctcctgcacccgcactacggctacccgttcaccctggcg
ctccagatcgagttcaccgtggacggacgcggggtgagcagcaggctgtcggcgaagaac
gtcggtgacaccgacgccccgttcggcaccgcgaaccacacctacatcgccgccagcgga
ccggccatcgacaccatgggcttcgagctgcccgcgagcacctactacgtcaccgacgac
aacctcatcccgaccgggaccgcaccggtcgcgggcaccgagtacgacttccgctcggcg
cggcggatcggcgccaccaagatggacaccgctttcaccgacctggcaagggaatccggc
ggggaggcggtggtccgcttcgagcgccctggcgggcagcacgtcgagctctgggtggac
cggacccacggttacctgcaggtctacaccgacgactcgccgtcgcaggaccgcccggcc
cgcgcgggcatcaccgtcgagccgatgacgtgcgctcccaacgcgttcgtgaccggcgac
ggcctgatcaccctgcggcccggcgaggtgcacgagggccgctggggctaccgaatcggt
tga

DBGET integrated database retrieval system