KEGG   Saccharopolyspora erythraea: SACE_4004Help
Entry
SACE_4004         CDS       T00492                                 

Gene name
bglC
Definition
endo-1,3-beta-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SACE_4004 (bglC)
Enzymes [BR:sen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SACE_4004 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4398082..4399089)
Genome map
AA seq 335 aa AA seqDB search
MRWQNSLRTAALAAMLVAVGAVADAAPPAAPEPTPVAVNGKLSVCGNTLCGSGAPVQLRG
MSTHGLQWYGQCVNDESLDALAHDWQADVLRISMYVQEGGYEEDPERFTAMVNQYVEAAT
RRGMYAIIDWHMLDPGDPNYNLERARTFFTEVARTHRDKPNVLYEVANEPNGVEWPAIKS
YAEQVIPVIRAQDPDSVVLVGTRAWSSLGVSDGADEQEIVDNPVDAGNILYTFHFYAASH
GEDHLRTLSRAADRLPLFVTEFGTQEASGDGGDDFAMAQRYLDLMAEKNISWTNWNFSDD
HRSGAVFEEGTCDSGPYTGTEPLKPAGVWVRERVR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagatggcagaactcccttcgcacggcggctctcgccgcgatgctggtcgcggtgggc
gcggtcgcggacgccgcgccgcccgccgcgccggagcccaccccggtggcggtgaacggc
aagctctcggtgtgcggcaacaccttgtgcggcagcggcgcaccggtgcagctgcgcggc
atgagcacgcacggcctgcagtggtacggccagtgcgtcaacgacgagtcgctcgacgcg
ctcgcccacgactggcaggccgacgtgctgcggatctccatgtacgtccaggaaggcggc
tacgaggaggacccggaacgcttcaccgcgatggtgaaccagtacgtcgaggccgcgacg
cggcgggggatgtacgcgatcatcgactggcacatgctcgatcccggtgaccccaattac
aacctcgaacgggcccggacgttcttcaccgaggtcgcccgcacccaccgcgacaagccc
aacgtcctctacgaggtcgccaacgagcccaacggcgtcgagtggcccgcgatcaagagc
tacgccgagcaggtcatcccggtgatccgggcgcaggaccccgactcggtggtgctggtc
ggcacccgcgcgtggtcgtcgctgggcgtctccgacggagccgacgagcaggagatcgtc
gacaacccggtcgacgcgggcaacatcctctacaccttccacttctacgccgcgtcccac
ggcgaggaccacctgcgcacgctgtcgcgggcggcggaccggctgccgctgttcgtcacc
gagttcggcacccaggaggcgtccggcgacggcggcgacgacttcgccatggcgcagcgc
tacctcgacctgatggcggagaagaacatcagctggaccaactggaacttctccgacgac
caccggtcgggcgcggtgttcgaggagggcacctgcgacagcgggccctacaccggcacc
gagccgctcaagccggccggggtgtgggtccgcgagcgggtccggtga

DBGET integrated database retrieval system