KEGG   Saccharopolyspora erythraea: SACE_4085Help
Entry
SACE_4085         CDS       T00492                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SACE_4085 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4085 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_4085 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_4085 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_4085 (adh)
   00626 Naphthalene degradation
    SACE_4085 (adh)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_4085 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4495599..4496654)
Genome map
AA seq 351 aa AA seqDB search
MRAVVIDEFGRTPVVREVPDPEPSRLGAVVRVEATGLCRSDWHGWMGHDPDIALPHVPGH
ELSGVVESVGAEVANWRPGDRVTVPFVCACGRCAECARGDQQVCAHQTQPGFTHWGSFAE
FVSLENADVNLVAVPEAMSFATAAGLGCRFATAFRAVVAQGRVAAGQWVAVHGCGGVGLS
AVMIAAACGAAVVAVDISPDALALARRFGAKECLDPSALPVSVAEAVAGITGGGAHVSID
ALGSPRTCANSIASLRSRGRHVQVGLLPQAAGDPSLPMSRVIALELEVLGSHGMAAHEYP
AMMEMVAAGSLRPDRLVTNAIGLEQAPEALAAMGAGAGPGVTVVEPHRRAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtggtgatcgacgagttcggcaggaccccggtcgtccgcgaggtgcccgat
ccggagccgtcgcggctcggcgcggtggtgcgcgtcgaggcgaccgggctgtgccgcagc
gactggcacggctggatgggccacgacccggacatcgcgctgccgcacgtgcccgggcac
gagctgtccggcgtcgtcgagtcggtgggcgccgaggtcgccaactggcggcccggcgac
cgggtcacggtgcctttcgtctgcgcgtgcggccggtgcgccgagtgcgcgcggggcgac
cagcaggtgtgcgcgcaccagacgcagccgggcttcacgcactggggttccttcgccgag
ttcgtgtcgctggagaacgccgacgtcaacctcgtggcagtgccggaggcgatgtcgttc
gcgaccgcggccgggctcggctgccggttcgcgacggccttccgcgcggtggtcgcccag
ggccgggtggcggcggggcagtgggtcgcggtgcacggctgcggtggggtggggctgtcc
gcggtgatgatcgccgccgcctgcggtgccgccgtggtcgcggtcgacatctcaccggac
gcgctcgctctggcgcgccgcttcggcgcgaaggagtgcctggacccctcggcgctgccg
gtgtcggtggccgaggcggtggccgggatcaccggcggtggtgcgcacgtgtcgatcgac
gcgctcggcagcccgcggacctgcgccaactcgatcgcgagcctgcgcagccgcggcagg
cacgtgcaggtcggcctgctgccgcaggcggcgggcgacccgagcctgccgatgtcgcgg
gtcatcgcgctcgaactggaggtgctgggcagccacggcatggccgcgcacgagtacccg
gcgatgatggagatggtcgccgccggttcactgcgcccggaccggctggtgaccaacgcg
atcggcctggagcaggcaccggaggcgctcgccgctatgggcgcaggagcgggcccgggt
gtgaccgtcgtggaaccgcaccggcgcgcctcctag

DBGET integrated database retrieval system