KEGG   Saccharopolyspora erythraea: SACE_4085Help
Entry
SACE_4085         CDS       T00492                                 

Gene name
adh
Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
sen  Saccharopolyspora erythraea
Pathway
sen00010  Glycolysis / Gluconeogenesis
sen00071  Fatty acid degradation
sen00350  Tyrosine metabolism
sen00625  Chloroalkane and chloroalkene degradation
sen00626  Naphthalene degradation
sen01100  Metabolic pathways
sen01110  Biosynthesis of secondary metabolites
sen01120  Microbial metabolism in diverse environments
sen01130  Biosynthesis of antibiotics
sen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4085 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_4085 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_4085 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_4085 (adh)
   00626 Naphthalene degradation
    SACE_4085 (adh)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_4085 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Methyltransf_25 Methyltransf_11 2-Hacid_dh_C 3HCDH_N ELFV_dehydrog UDPG_MGDP_dh_N Methyltransf_12 OAR
Motif
Other DBs
NCBI-ProteinID: CAM03356
Cambridge: SACE_4085
Kitasato: SACE_4085
UniProt: A4FH31
Position
complement(4495599..4496654)
Genome map
AA seq 351 aa AA seqDB search
MRAVVIDEFGRTPVVREVPDPEPSRLGAVVRVEATGLCRSDWHGWMGHDPDIALPHVPGH
ELSGVVESVGAEVANWRPGDRVTVPFVCACGRCAECARGDQQVCAHQTQPGFTHWGSFAE
FVSLENADVNLVAVPEAMSFATAAGLGCRFATAFRAVVAQGRVAAGQWVAVHGCGGVGLS
AVMIAAACGAAVVAVDISPDALALARRFGAKECLDPSALPVSVAEAVAGITGGGAHVSID
ALGSPRTCANSIASLRSRGRHVQVGLLPQAAGDPSLPMSRVIALELEVLGSHGMAAHEYP
AMMEMVAAGSLRPDRLVTNAIGLEQAPEALAAMGAGAGPGVTVVEPHRRAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgtggtgatcgacgagttcggcaggaccccggtcgtccgcgaggtgcccgat
ccggagccgtcgcggctcggcgcggtggtgcgcgtcgaggcgaccgggctgtgccgcagc
gactggcacggctggatgggccacgacccggacatcgcgctgccgcacgtgcccgggcac
gagctgtccggcgtcgtcgagtcggtgggcgccgaggtcgccaactggcggcccggcgac
cgggtcacggtgcctttcgtctgcgcgtgcggccggtgcgccgagtgcgcgcggggcgac
cagcaggtgtgcgcgcaccagacgcagccgggcttcacgcactggggttccttcgccgag
ttcgtgtcgctggagaacgccgacgtcaacctcgtggcagtgccggaggcgatgtcgttc
gcgaccgcggccgggctcggctgccggttcgcgacggccttccgcgcggtggtcgcccag
ggccgggtggcggcggggcagtgggtcgcggtgcacggctgcggtggggtggggctgtcc
gcggtgatgatcgccgccgcctgcggtgccgccgtggtcgcggtcgacatctcaccggac
gcgctcgctctggcgcgccgcttcggcgcgaaggagtgcctggacccctcggcgctgccg
gtgtcggtggccgaggcggtggccgggatcaccggcggtggtgcgcacgtgtcgatcgac
gcgctcggcagcccgcggacctgcgccaactcgatcgcgagcctgcgcagccgcggcagg
cacgtgcaggtcggcctgctgccgcaggcggcgggcgacccgagcctgccgatgtcgcgg
gtcatcgcgctcgaactggaggtgctgggcagccacggcatggccgcgcacgagtacccg
gcgatgatggagatggtcgccgccggttcactgcgcccggaccggctggtgaccaacgcg
atcggcctggagcaggcaccggaggcgctcgccgctatgggcgcaggagcgggcccgggt
gtgaccgtcgtggaaccgcaccggcgcgcctcctag

DBGET integrated database retrieval system