KEGG   Saccharopolyspora erythraea: SACE_4163Help
Entry
SACE_4163         CDS       T00492                                 

Gene name
adh1
Definition
zinc-binding dehydrogenase (EC:1.1.1.1 1.6.5.5)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
sen  Saccharopolyspora erythraea
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SACE_4163 (adh1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SACE_4163 (adh1)
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_4163 (adh1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SACE_4163 (adh1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SACE_4163 (adh1)
   00626 Naphthalene degradation
    SACE_4163 (adh1)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SACE_4163 (adh1)
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     SACE_4163 (adh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4634534..4635544)
Genome map
AA seq 336 aa AA seqDB search
MRAAIVDRPGSVRVGDVQDPSPGERDVVIKVGACGICGTDLHIADGHFPPTPYPIVPGHE
FAGEVVELGSEAPGGFEIGDRVAVDPSLFCGYCTPCRSGHGNLCANWNATGDTVNGAFAE
YVSVPAATCYRMPDEMTWEQGALVEPVSCAVHGVRQIGVEAGERFLVVGAGTMGLLMQQL
LQRGGAHVTVVDRNTARLGRASRLGAVAVAGDVAELDGERFDAAVDCTGAAPAIEAAFDS
LRRGGRLLVFGVAPAEARVSLSPFRIYNDEITIVGSMAVLHSYGAALDLVASGAVNTEEL
LTDRLTLEDFPKALELMRSGAGLKVQVLPGGVDADA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccgcgatcgttgaccggcccggttcggtccgggtgggcgacgtgcaggacccc
agtccgggggagcgggacgtggtgatcaaggtcggtgcctgcggcatctgcggcacggac
ctgcacatcgccgacgggcacttcccgcccaccccatacccgatcgtgcccgggcacgag
ttcgccggtgaggtggtcgagctcggttccgaggcaccgggtggcttcgagatcggtgac
cgcgtggcggtggacccgtcgctgttctgcggctactgcaccccctgccgctccgggcac
ggcaacctctgcgcgaactggaacgccaccggcgacaccgtcaacggtgcgttcgccgag
tacgtgtcggtacccgccgcgacctgctaccggatgcccgacgagatgacctgggagcag
ggcgcgctggtcgagccggtgtcgtgcgcggtgcacggcgtgcgccagatcggcgtcgaa
gccggcgagcgcttcctggtcgtcggcgcgggcacgatgggcctgctgatgcagcagctg
ctgcagcgcggtggcgcccacgtcacggtcgtcgaccgcaacaccgctcggctgggccgg
gcgagcaggctgggcgcggtggccgtggccggcgacgtcgccgagctggacggcgagcgc
ttcgacgccgcggtggactgcaccggagcggcccccgcgatcgaggcggccttcgactcg
ctgcgccgcggcggccggctgctggtgttcggggtcgccccggccgaggcaagggtgtcg
ctgtcgccgttccgcatctacaacgacgagatcaccatcgtcggctcgatggcggtgctg
cacagctacggcgcggcgctggacctggtggcctccggcgcggtgaacaccgaggagctg
ctcaccgacaggctgacgctggaggacttccccaaggcgctggaactgatgcgcagcggt
gcgggactgaaggtgcaggtgctaccgggaggtgtcgatgccgatgcgtag

DBGET integrated database retrieval system