KEGG   Saccharopolyspora erythraea: SACE_4205Help
Entry
SACE_4205         CDS       T00492                                 

Gene name
cypD
Definition
bifunctional P-450:NADPH-P450 reductase 1 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sen00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    SACE_4205 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    SACE_4205 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SACE_4205 (cypD)
Enzymes [BR:sen01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SACE_4205 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     SACE_4205 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4676800..4679985)
Genome map
AA seq 1061 aa AA seqDB search
MTQTPLHHDDVPVADVSGTGLTATPTQQAMELARRHGPVFRRRTREFQSLLVSDVDLVAE
LSDEQRFAKAVGPALENVREFAADGLFTAYNDEFNWAKAHDILMPAFALGSMRTYHPVML
RVARRLLDSWDRAAAASAPVDVPDDMTRMTLDTIGLAGFGFDFGSFGRAEPHPFVGAMVR
CLDWSMTRLSRVPGTDHSERDEAFRADARYLASVVDEVINTRAAEGDTSGEDLLGLMLGA
RHPADGTTLDAANIRNQIITFLIAGHETTSGTLSFALHYLAKNPTVLRLVQREADELWGD
SPDPEPSFEDIGRLTYTRQVLNETLRLWPSAPAFGRQARHDTVLGGRIPMRAGEAAAVLI
PMLHRSPVRGDNPELFDPARFAPEAEAARGPHAFKPFGTGERACIGRQFALDEATMVLAM
LAHRYRLVDHAGYRLKVKETLTLKPEGLTLAVRARTAADRVTNRLALPVGLPSAAPGEPA
DAARRPGRVLPGTGLLLLHGSNYGTCRDFAAQLALAAGELGCDTAVAPLDEYAGNLPSDR
PVIVVAASYNGRPTDDAVSFSRWLDEAEPGAADGVDFAVLGVGDRNWAATYQHVPTRIDA
RLAELGGTRILERGEADASGDLAGAVRRFSAALETALLERSGDPDAVAAAPEGDGPAYTV
SEVTGGALDSLAARHGMVEMTVTEVADLTAPDYPRTKRFVRLALPEGTAYRTADHLAVLP
VHDAALVERAAGVLGVDLDTVLDIRAKRPGRLTFDRSLTVRELLSHHVELQDPPTPDGLD
ALAALNPCPPERAALRGLAEEARSGTADHRTLWDLIEDHPALRDALSWSALLELLPATRP
RQYSVSSSPAVDPRHVDLMVSVLRAPARSGRGEFRGAGSRHLSEVRPGDTVLARVQPCRE
DFRVAPDEPLIMVAAGTGLAPFRGVIADRRERVANGARQAPALCYFGCDAPDADYLHSAE
LRAAESAGAVAMRPAFNEAPVGGQCFVQHRIAAEAGEVWALLESGARVLVCGDGRHMAPG
VREAFRGIYRERTPGADDASAHEWLQAMIAGGCYVEDVYAG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccccgctccaccacgacgacgtccccgtcgccgacgtctccggcaccggg
ctcaccgccacgcccacccagcaggcgatggagctggcccggcggcacggcccggtgttc
cggcgccgcacccgcgagttccagagcctgctggtcagcgacgtcgacctggtggcggag
ctgtccgacgagcagcggttcgccaaggccgtcggtccggcgctggagaacgtgcgggag
ttcgccgccgacggcctgttcaccgcctacaacgacgaattcaactgggcgaaggcgcac
gacatcctgatgcccgccttcgcactgggatcgatgcgcacctaccacccggtgatgctg
cgggtggcccggcggctgctggactcctgggaccgcgccgccgcggcgtcggcgccggtc
gacgtgcccgacgacatgacccggatgacgctggacaccatcggcctggccggcttcggt
ttcgacttcggttctttcggccgcgccgagccgcaccccttcgtcggcgccatggtgcgg
tgcctggactggagcatgacccggctgagccgggtgccgggaaccgaccacagcgagcgc
gacgaggccttccgcgccgacgcgcgctacctggcctcggtggtcgacgaggtgatcaac
acgcgggcggccgagggggacacctcgggggaggacctgctcggcctcatgctcggcgcc
aggcaccccgccgacggcaccacgctggacgcggccaacatccgcaaccagatcatcacc
ttcctgatcgccggccacgagacgacctcgggcaccctgtcgttcgccctgcactacctc
gcgaagaacccgacggtgctgcggctggtccagcgcgaggccgacgagctgtggggcgac
agcccggacccggagccgtccttcgaggacatcgggcggctgacctacacccggcaggtc
ctcaacgagacgctgcggctgtggccgtcggcgcccgccttcggccgccaggcccgccac
gacaccgtgctcggcggccggatcccgatgcgcgcgggggaggcggcggccgtgctcatc
ccgatgctgcaccgcagcccggtgcggggcgacaacccggagctgttcgatcccgcgcgc
ttcgccccggaagccgaggcggcacgcggcccgcacgccttcaagccgttcggcaccgga
gaacgcgcgtgcatcggacggcagttcgcgctagacgaggcgaccatggtgctggcgatg
ctggcgcaccgctaccggctcgtcgaccacgccggctaccggttgaaggtcaaggaaacc
ctgacgctcaagccggaggggctgacactcgccgtgcgtgcgcgcaccgccgcagaccgg
gtcaccaaccggctcgcgttgccggtaggactcccttccgcggcgcccggtgagcccgcc
gacgccgcccggcggcccggccgcgtcctgccgggcacgggactcctgctcctgcacggt
tccaactacgggacctgccgcgatttcgcggctcagctcgccctggcggccggagagctc
ggctgcgacacggcggtcgccccgctcgacgagtacgccgggaatctgccgtccgaccgg
cccgtgatcgtggtcgccgcgtcctacaacggccggccgaccgacgacgcggtgtcgttc
tcgcggtggctcgacgaggccgagccgggtgccgccgacggcgtcgacttcgccgtgctc
ggcgtcggcgaccgcaactgggcggcgacctaccagcacgtgcccacgcgcatcgacgcc
cggctcgccgagctcggcggcacccggatcctcgagcgcggcgaagccgacgcctcgggc
gacctggccggtgcggtgcgccggttcagcgcggcgctggagaccgcgctgctggaacgc
agcggcgatcccgacgcggtggccgccgcgccggaaggggacgggcccgcctacaccgtc
tcggaggtgaccggcggagcgctggactcgctcgccgcacggcacggcatggtcgagatg
accgtcaccgaggtcgccgacctcaccgcgccggactacccgcgcaccaagcgcttcgtg
cgcctcgcgctcccggagggcaccgcctaccggacggcggaccacctggcggtgctgccg
gtgcacgacgccgcgctcgtcgaacgcgcggccggtgtgctgggcgtggacctcgacacc
gtgctcgacatcagggcgaagcgtcccgggcggctcaccttcgaccggtcgctcacggtc
cgcgagctgctgtcccaccacgtcgagttgcaggacccgccgacccccgacggactcgac
gcgctcgcggcgctcaacccgtgcccgccggagcgggccgcgctgcgcggtctggccgag
gaagcgcgctcggggacggcggaccaccggacgctgtgggatctcatcgaggaccacccg
gcgttgcgcgacgcgctgagctggtccgctctgctcgaactgctgcctgcgacgaggccc
cggcagtactcggtctcctcgtcgccggccgtggacccccggcacgtggacctgatggtg
tccgtgctgcgcgcaccggcccggtccgggcgcggggagttccggggcgccgggtcgcgc
cacctgagcgaggtgcggccgggcgacaccgtcctggcccgcgtgcagccgtgccgggag
gacttccgcgtggcgcccgatgagccgctgatcatggtcgcggccgggaccggcctcgct
cccttccgcggcgtcatcgccgaccggcgggagcgggtcgccaacggcgcccggcaggct
ccggcgctgtgctacttcggctgcgacgcccccgacgccgactacctgcactcggcggag
ctgcgggcggccgagtcggcgggcgcggtggcgatgcggcccgccttcaacgaggcgccg
gtcggcgggcagtgcttcgtccagcaccgcatcgccgccgaggccggcgaggtgtgggcg
ctgctcgagtcgggcgcgcgggtcctggtctgcggcgacggccgccacatggcgccgggc
gtgcgcgaggcgttccgcggcatctaccgcgagcgcacgcccggcgccgacgacgcctcc
gcgcatgagtggctgcaggcgatgatcgccggaggctgctacgtcgaagacgtctacgcg
ggctga

DBGET integrated database retrieval system