KEGG   Saccharopolyspora erythraea: SACE_4205Help
Entry
SACE_4205         CDS       T00492                                 

Gene name
cypD
Definition
bifunctional P-450:NADPH-P450 reductase 1 (EC:1.14.14.1 1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
sen  Saccharopolyspora erythraea
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sen00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:sen00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sen00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Cambridge: 
Kitasato: 
UniProt: 
Position
complement(4676800..4679985)
Genome map
AA seq 1061 aa AA seqDB search
MTQTPLHHDDVPVADVSGTGLTATPTQQAMELARRHGPVFRRRTREFQSLLVSDVDLVAE
LSDEQRFAKAVGPALENVREFAADGLFTAYNDEFNWAKAHDILMPAFALGSMRTYHPVML
RVARRLLDSWDRAAAASAPVDVPDDMTRMTLDTIGLAGFGFDFGSFGRAEPHPFVGAMVR
CLDWSMTRLSRVPGTDHSERDEAFRADARYLASVVDEVINTRAAEGDTSGEDLLGLMLGA
RHPADGTTLDAANIRNQIITFLIAGHETTSGTLSFALHYLAKNPTVLRLVQREADELWGD
SPDPEPSFEDIGRLTYTRQVLNETLRLWPSAPAFGRQARHDTVLGGRIPMRAGEAAAVLI
PMLHRSPVRGDNPELFDPARFAPEAEAARGPHAFKPFGTGERACIGRQFALDEATMVLAM
LAHRYRLVDHAGYRLKVKETLTLKPEGLTLAVRARTAADRVTNRLALPVGLPSAAPGEPA
DAARRPGRVLPGTGLLLLHGSNYGTCRDFAAQLALAAGELGCDTAVAPLDEYAGNLPSDR
PVIVVAASYNGRPTDDAVSFSRWLDEAEPGAADGVDFAVLGVGDRNWAATYQHVPTRIDA
RLAELGGTRILERGEADASGDLAGAVRRFSAALETALLERSGDPDAVAAAPEGDGPAYTV
SEVTGGALDSLAARHGMVEMTVTEVADLTAPDYPRTKRFVRLALPEGTAYRTADHLAVLP
VHDAALVERAAGVLGVDLDTVLDIRAKRPGRLTFDRSLTVRELLSHHVELQDPPTPDGLD
ALAALNPCPPERAALRGLAEEARSGTADHRTLWDLIEDHPALRDALSWSALLELLPATRP
RQYSVSSSPAVDPRHVDLMVSVLRAPARSGRGEFRGAGSRHLSEVRPGDTVLARVQPCRE
DFRVAPDEPLIMVAAGTGLAPFRGVIADRRERVANGARQAPALCYFGCDAPDADYLHSAE
LRAAESAGAVAMRPAFNEAPVGGQCFVQHRIAAEAGEVWALLESGARVLVCGDGRHMAPG
VREAFRGIYRERTPGADDASAHEWLQAMIAGGCYVEDVYAG
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccccgctccaccacgacgacgtccccgtcgccgacgtctccggcaccggg
ctcaccgccacgcccacccagcaggcgatggagctggcccggcggcacggcccggtgttc
cggcgccgcacccgcgagttccagagcctgctggtcagcgacgtcgacctggtggcggag
ctgtccgacgagcagcggttcgccaaggccgtcggtccggcgctggagaacgtgcgggag
ttcgccgccgacggcctgttcaccgcctacaacgacgaattcaactgggcgaaggcgcac
gacatcctgatgcccgccttcgcactgggatcgatgcgcacctaccacccggtgatgctg
cgggtggcccggcggctgctggactcctgggaccgcgccgccgcggcgtcggcgccggtc
gacgtgcccgacgacatgacccggatgacgctggacaccatcggcctggccggcttcggt
ttcgacttcggttctttcggccgcgccgagccgcaccccttcgtcggcgccatggtgcgg
tgcctggactggagcatgacccggctgagccgggtgccgggaaccgaccacagcgagcgc
gacgaggccttccgcgccgacgcgcgctacctggcctcggtggtcgacgaggtgatcaac
acgcgggcggccgagggggacacctcgggggaggacctgctcggcctcatgctcggcgcc
aggcaccccgccgacggcaccacgctggacgcggccaacatccgcaaccagatcatcacc
ttcctgatcgccggccacgagacgacctcgggcaccctgtcgttcgccctgcactacctc
gcgaagaacccgacggtgctgcggctggtccagcgcgaggccgacgagctgtggggcgac
agcccggacccggagccgtccttcgaggacatcgggcggctgacctacacccggcaggtc
ctcaacgagacgctgcggctgtggccgtcggcgcccgccttcggccgccaggcccgccac
gacaccgtgctcggcggccggatcccgatgcgcgcgggggaggcggcggccgtgctcatc
ccgatgctgcaccgcagcccggtgcggggcgacaacccggagctgttcgatcccgcgcgc
ttcgccccggaagccgaggcggcacgcggcccgcacgccttcaagccgttcggcaccgga
gaacgcgcgtgcatcggacggcagttcgcgctagacgaggcgaccatggtgctggcgatg
ctggcgcaccgctaccggctcgtcgaccacgccggctaccggttgaaggtcaaggaaacc
ctgacgctcaagccggaggggctgacactcgccgtgcgtgcgcgcaccgccgcagaccgg
gtcaccaaccggctcgcgttgccggtaggactcccttccgcggcgcccggtgagcccgcc
gacgccgcccggcggcccggccgcgtcctgccgggcacgggactcctgctcctgcacggt
tccaactacgggacctgccgcgatttcgcggctcagctcgccctggcggccggagagctc
ggctgcgacacggcggtcgccccgctcgacgagtacgccgggaatctgccgtccgaccgg
cccgtgatcgtggtcgccgcgtcctacaacggccggccgaccgacgacgcggtgtcgttc
tcgcggtggctcgacgaggccgagccgggtgccgccgacggcgtcgacttcgccgtgctc
ggcgtcggcgaccgcaactgggcggcgacctaccagcacgtgcccacgcgcatcgacgcc
cggctcgccgagctcggcggcacccggatcctcgagcgcggcgaagccgacgcctcgggc
gacctggccggtgcggtgcgccggttcagcgcggcgctggagaccgcgctgctggaacgc
agcggcgatcccgacgcggtggccgccgcgccggaaggggacgggcccgcctacaccgtc
tcggaggtgaccggcggagcgctggactcgctcgccgcacggcacggcatggtcgagatg
accgtcaccgaggtcgccgacctcaccgcgccggactacccgcgcaccaagcgcttcgtg
cgcctcgcgctcccggagggcaccgcctaccggacggcggaccacctggcggtgctgccg
gtgcacgacgccgcgctcgtcgaacgcgcggccggtgtgctgggcgtggacctcgacacc
gtgctcgacatcagggcgaagcgtcccgggcggctcaccttcgaccggtcgctcacggtc
cgcgagctgctgtcccaccacgtcgagttgcaggacccgccgacccccgacggactcgac
gcgctcgcggcgctcaacccgtgcccgccggagcgggccgcgctgcgcggtctggccgag
gaagcgcgctcggggacggcggaccaccggacgctgtgggatctcatcgaggaccacccg
gcgttgcgcgacgcgctgagctggtccgctctgctcgaactgctgcctgcgacgaggccc
cggcagtactcggtctcctcgtcgccggccgtggacccccggcacgtggacctgatggtg
tccgtgctgcgcgcaccggcccggtccgggcgcggggagttccggggcgccgggtcgcgc
cacctgagcgaggtgcggccgggcgacaccgtcctggcccgcgtgcagccgtgccgggag
gacttccgcgtggcgcccgatgagccgctgatcatggtcgcggccgggaccggcctcgct
cccttccgcggcgtcatcgccgaccggcgggagcgggtcgccaacggcgcccggcaggct
ccggcgctgtgctacttcggctgcgacgcccccgacgccgactacctgcactcggcggag
ctgcgggcggccgagtcggcgggcgcggtggcgatgcggcccgccttcaacgaggcgccg
gtcggcgggcagtgcttcgtccagcaccgcatcgccgccgaggccggcgaggtgtgggcg
ctgctcgagtcgggcgcgcgggtcctggtctgcggcgacggccgccacatggcgccgggc
gtgcgcgaggcgttccgcggcatctaccgcgagcgcacgcccggcgccgacgacgcctcc
gcgcatgagtggctgcaggcgatgatcgccggaggctgctacgtcgaagacgtctacgcg
ggctga

DBGET integrated database retrieval system